(data stored in ACNUC7421 zone)

EMBL: CP000821.PE169

CP000821.PE169       Location/Qualifiers
FT   CDS             complement(191748..191966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0169"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mem:Memar_1885 protein of unknown function
FT                   UPF0066"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34782"
FT                   /db_xref="InterPro:IPR023370"
FT                   /db_xref="InterPro:IPR036413"
FT                   /db_xref="InterPro:IPR036414"
FT                   /db_xref="InterPro:IPR040372"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPK9"
FT                   /protein_id="ABV34782.1"
FT                   /translation="MIEFTPIGLSIVEIERVEANRIFVRGIDLLDGTPILDIKPYIQSF
FT                   DNIKDTKDGSYERGFDPLTVRSDKRFA"
     MIEFTPIGLS IVEIERVEAN RIFVRGIDLL DGTPILDIKP YIQSFDNIKD TKDGSYERGF        60
     DPLTVRSDKR FA                                                            72
//

If you have problems or comments...

PBIL Back to PBIL home page