(data stored in ACNUC7421 zone)

EMBL: CP000821.PE17

CP000821.PE17        Location/Qualifiers
FT   CDS             19576..20742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0017"
FT                   /product="Chloramphenicol O-acetyltransferase"
FT                   /EC_number="2.3.1.28"
FT                   /note="KEGG: ppr:PBPRA3400 putative transport permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34630"
FT                   /db_xref="GOA:A8FP57"
FT                   /db_xref="InterPro:IPR024989"
FT                   /db_xref="InterPro:IPR026032"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A8FP57"
FT                   /protein_id="ABV34630.1"
FT                   /translation="MSHKSAAFIWCSNYVFQFFFCFGIFLPFYQLWLSEQGMGSESIGI
FT                   ILAVGLMSRCVASIVGGILAKHESQYQNVLRVVSALGLCTAVSMVYWSPSFYHLLILTV
FT                   LFNAAIAPVFGLSDAIIATLDKRKILSYGPTRMWGSLGFVGATVVGGYCFELWTISVLP
FT                   IILIISCSLMLFSVTLKCPDLQTARSQHKVLEEDGKHWLGAELILLLGILSLLQGSHGF
FT                   FYGFSSVYWQEIGIAEGVIGYLWGISIVSEILVFIFAKKAFSNVSPKLLLQIASAGVLV
FT                   RWGALSLAEQPLYIALSQTLHGVTFAMTHLAAIKSIQLYLPESQMAKFQGLYNGLYMAV
FT                   TALVTFITGYLFDSLKADLFIAMALFGVVGFVLTFSLNLKPIKNPVTV"
     MSHKSAAFIW CSNYVFQFFF CFGIFLPFYQ LWLSEQGMGS ESIGIILAVG LMSRCVASIV        60
     GGILAKHESQ YQNVLRVVSA LGLCTAVSMV YWSPSFYHLL ILTVLFNAAI APVFGLSDAI       120
     IATLDKRKIL SYGPTRMWGS LGFVGATVVG GYCFELWTIS VLPIILIISC SLMLFSVTLK       180
     CPDLQTARSQ HKVLEEDGKH WLGAELILLL GILSLLQGSH GFFYGFSSVY WQEIGIAEGV       240
     IGYLWGISIV SEILVFIFAK KAFSNVSPKL LLQIASAGVL VRWGALSLAE QPLYIALSQT       300
     LHGVTFAMTH LAAIKSIQLY LPESQMAKFQ GLYNGLYMAV TALVTFITGY LFDSLKADLF       360
     IAMALFGVVG FVLTFSLNLK PIKNPVTV                                          388
//

If you have problems or comments...

PBIL Back to PBIL home page