(data stored in ACNUC7421 zone)

EMBL: CP000821.PE171

CP000821.PE171       Location/Qualifiers
FT   CDS             193063..194862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0171"
FT                   /product="thiamine pyrophosphate enzyme domain protein
FT                   TPP-binding"
FT                   /note="KEGG: slo:Shew_3635 thiamine pyrophosphate enzyme
FT                   domain protein TPP-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34784"
FT                   /db_xref="GOA:A8FPL1"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPL1"
FT                   /protein_id="ABV34784.1"
FT                   /translation="MSPSIKDNFGSEYYNSLPLFGDCLGELLAFFGVKRAYGVGGDFVA
FT                   NLINSLEGHIEVLPSSNEMHAGFSACAQAELNPLGMCLTTYTVGSLPCVTAAALARTEG
FT                   LPVVFISGAPGEAEVNSHALHHSVHPHTAWHTDLDAALNSFRALGVRAERLQGQRHSGQ
FT                   PNIAAEQCLELLTYAYLNRQPVFIEIPRDLINQPTQSLSLPLSLEQISQNQPLSLSGAE
FT                   LIAQDIESKLKLANKPLVFLGEKLRLNRPLLSKIISLCHQHSLPYATSWFGKGMLDESE
FT                   PLCLGSYNGAFSELEGKHYIESQADYILELGTAIFPSDTNNAFSSQTHAIDTHSHKTML
FT                   RGTARWEKDIEAVIDLLVQKLPLNEGAESTLDPDEKVTPPLESVMLGYHNLAETINQAQ
FT                   RQLAKPYIFVPEVGSSLFASFELETHGSDIGRSYLANPWYAAMGTCLPYARAIADQLAE
FT                   SNSLQPVLVMIGDGGFNFQANELINLQKQGANVTILYMRNNIFHLGKAGDAPIYSCNDQ
FT                   GFNPRLLIQAYGGDGHLCETTEQLTHCLIETAHKGGVHLIEVPTSVEAGHQSETTKKLN
FT                   TYIGFRNGDPQATERWNELCGHF"
     MSPSIKDNFG SEYYNSLPLF GDCLGELLAF FGVKRAYGVG GDFVANLINS LEGHIEVLPS        60
     SNEMHAGFSA CAQAELNPLG MCLTTYTVGS LPCVTAAALA RTEGLPVVFI SGAPGEAEVN       120
     SHALHHSVHP HTAWHTDLDA ALNSFRALGV RAERLQGQRH SGQPNIAAEQ CLELLTYAYL       180
     NRQPVFIEIP RDLINQPTQS LSLPLSLEQI SQNQPLSLSG AELIAQDIES KLKLANKPLV       240
     FLGEKLRLNR PLLSKIISLC HQHSLPYATS WFGKGMLDES EPLCLGSYNG AFSELEGKHY       300
     IESQADYILE LGTAIFPSDT NNAFSSQTHA IDTHSHKTML RGTARWEKDI EAVIDLLVQK       360
     LPLNEGAEST LDPDEKVTPP LESVMLGYHN LAETINQAQR QLAKPYIFVP EVGSSLFASF       420
     ELETHGSDIG RSYLANPWYA AMGTCLPYAR AIADQLAESN SLQPVLVMIG DGGFNFQANE       480
     LINLQKQGAN VTILYMRNNI FHLGKAGDAP IYSCNDQGFN PRLLIQAYGG DGHLCETTEQ       540
     LTHCLIETAH KGGVHLIEVP TSVEAGHQSE TTKKLNTYIG FRNGDPQATE RWNELCGHF        599
//

If you have problems or comments...

PBIL Back to PBIL home page