(data stored in ACNUC7421 zone)

EMBL: CP000821.PE172

CP000821.PE172       Location/Qualifiers
FT   CDS             195071..195442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0172"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34785"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPL2"
FT                   /protein_id="ABV34785.1"
FT                   /translation="MDKTQYFYRTAIFTRKDNQVSLVDIEKPDDTTPMEDWMAIVVSLA
FT                   DGRHTVNELIAYMGSQYRSAPQELEDTLHSVLERLQEGKIVQLSEQAVELPYYLAEPIE
FT                   SLDIEKAKKLIKEDGYIHH"
     MDKTQYFYRT AIFTRKDNQV SLVDIEKPDD TTPMEDWMAI VVSLADGRHT VNELIAYMGS        60
     QYRSAPQELE DTLHSVLERL QEGKIVQLSE QAVELPYYLA EPIESLDIEK AKKLIKEDGY       120
     IHH                                                                     123
//

If you have problems or comments...

PBIL Back to PBIL home page