(data stored in ACNUC7421 zone)

EMBL: CP000821.PE173

CP000821.PE173       Location/Qualifiers
FT   CDS             195536..197950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0173"
FT                   /product="RNA binding S1 domain protein"
FT                   /note="KEGG: slo:Shew_3634 RNA binding S1 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34786"
FT                   /db_xref="GOA:A8FPL3"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018974"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR023319"
FT                   /db_xref="InterPro:IPR023323"
FT                   /db_xref="InterPro:IPR032639"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="InterPro:IPR041692"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPL3"
FT                   /protein_id="ABV34786.1"
FT                   /translation="MLSLAPLKSFYPGTTQLLMQMTQNIAQIIAQELNVREQQVTSTIT
FT                   LLDDGATVPFVARYRKEATGGLDDTQLRTLNSRLSYLRDLNDRRAVILSSIDTQGKLTP
FT                   ELKKALVDADSKTRLEDLYLPYKPKRRTKGQIAIEAGIEPLADYLFGNRQADIELEAGK
FT                   FINAEAGFADSKSVLDGARFIIMERFAEDAALLQKVRQHLSQNSVLESKMVKGKEKEGA
FT                   KFRDYFEHTEKLSKIPSHRALAMLRGRNEGMLSLSMNADPDNESKQSSYCAVIIADHFK
FT                   LNLTDSAVDQWLKTVVTATWRIKIALQMETEFLAKMREQAESEAINVFAKNLGDLLMAA
FT                   PAGAKATLGLDPGLRSGVKVAIVNNTGKLTAHTTIFPHAPQNQWDKSVRTLANLAKMHK
FT                   VELIAVGNGTASRETDKLAGELIASVKAELPGLTKIMVSEAGASVYSASELAANEFPDL
FT                   DVSIRGAVSIARRLQDPLAELVKIEPKSIGVGQYQHDVSQSQLSQSLEGVVEDCVNGVG
FT                   VDLNMASAPLLSQVAGLNKTLARNIVTYRDENGQFKQRKQLLKVARLGPKAYEQAAGFL
FT                   RIVDGDNPLDASSVHPEAYSLVESIAKAKDQALDTLMGNSELLRSLKAEDFITEKFGLP
FT                   TVTDILTELDKPGRDPRGEFKTATFKEGVEEVKDLKLDMILEGVVTNVTNFGAFVDVGV
FT                   HQDGLVHISSLTDKFVSDPHTVVKAGDVVKVKVMQVDVERKRIGLSMRLDEKAADMPAG
FT                   RSNQKSQTGSKPAAKSNQQGKGKPQHRSQPKQQANAAMGNAFADAFAKLKK"
     MLSLAPLKSF YPGTTQLLMQ MTQNIAQIIA QELNVREQQV TSTITLLDDG ATVPFVARYR        60
     KEATGGLDDT QLRTLNSRLS YLRDLNDRRA VILSSIDTQG KLTPELKKAL VDADSKTRLE       120
     DLYLPYKPKR RTKGQIAIEA GIEPLADYLF GNRQADIELE AGKFINAEAG FADSKSVLDG       180
     ARFIIMERFA EDAALLQKVR QHLSQNSVLE SKMVKGKEKE GAKFRDYFEH TEKLSKIPSH       240
     RALAMLRGRN EGMLSLSMNA DPDNESKQSS YCAVIIADHF KLNLTDSAVD QWLKTVVTAT       300
     WRIKIALQME TEFLAKMREQ AESEAINVFA KNLGDLLMAA PAGAKATLGL DPGLRSGVKV       360
     AIVNNTGKLT AHTTIFPHAP QNQWDKSVRT LANLAKMHKV ELIAVGNGTA SRETDKLAGE       420
     LIASVKAELP GLTKIMVSEA GASVYSASEL AANEFPDLDV SIRGAVSIAR RLQDPLAELV       480
     KIEPKSIGVG QYQHDVSQSQ LSQSLEGVVE DCVNGVGVDL NMASAPLLSQ VAGLNKTLAR       540
     NIVTYRDENG QFKQRKQLLK VARLGPKAYE QAAGFLRIVD GDNPLDASSV HPEAYSLVES       600
     IAKAKDQALD TLMGNSELLR SLKAEDFITE KFGLPTVTDI LTELDKPGRD PRGEFKTATF       660
     KEGVEEVKDL KLDMILEGVV TNVTNFGAFV DVGVHQDGLV HISSLTDKFV SDPHTVVKAG       720
     DVVKVKVMQV DVERKRIGLS MRLDEKAADM PAGRSNQKSQ TGSKPAAKSN QQGKGKPQHR       780
     SQPKQQANAA MGNAFADAFA KLKK                                              804
//

If you have problems or comments...

PBIL Back to PBIL home page