(data stored in ACNUC7421 zone)

EMBL: CP000821.PE175

CP000821.PE175       Location/Qualifiers
FT   CDS             complement(200314..200817)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0175"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: slo:Shew_3631 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34788"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPL5"
FT                   /protein_id="ABV34788.1"
FT                   /translation="MLVVTNYPQVPIATTNAATDSARTDNQQRPPVIPPKELTKGHEER
FT                   SFTPQHERTAEQADAQARLNERVQGKQQGTGQQHQEGKQQDQAKHAAPLLIKDLLRGKP
FT                   ALQRRDIQTSQQAVSPTPQKTDNERAIILDQPSEFYREFGQRVESFYQQQTHPHDEPAI
FT                   SALI"
     MLVVTNYPQV PIATTNAATD SARTDNQQRP PVIPPKELTK GHEERSFTPQ HERTAEQADA        60
     QARLNERVQG KQQGTGQQHQ EGKQQDQAKH AAPLLIKDLL RGKPALQRRD IQTSQQAVSP       120
     TPQKTDNERA IILDQPSEFY REFGQRVESF YQQQTHPHDE PAISALI                     167
//

If you have problems or comments...

PBIL Back to PBIL home page