(data stored in ACNUC7421 zone)

EMBL: CP000821.PE176

CP000821.PE176       Location/Qualifiers
FT   CDS             complement(200878..201672)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0176"
FT                   /product="Carboxylesterase"
FT                   /EC_number="3.1.1.1"
FT                   /note="KEGG: shm:Shewmr7_3882 BioH protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34789"
FT                   /db_xref="GOA:A8FPL6"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR010076"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPL6"
FT                   /protein_id="ABV34789.1"
FT                   /translation="MNPSPLHIESIGQGQEIIILHGWGVNSAVFTPLHSSLSQYRVHYV
FT                   DLPGFGHSSMIEGDIDAWVDAITSRLSHKAIWVGWSLGGLVATRAALRYPERVQGLVTI
FT                   ASSPCFMAREEESWPGIPPQVLSDFSKQLGSDLSKTIDRFLAIQAMGSVTAKDDIKQLR
FT                   ELVLSRPLPETTALVQGLDMLKSVDLRPQIAQIEQPWLRIWGRLDGLIPRRVPPLMPKD
FT                   EQLYQDLILHRASHAPFISHRDEFITGLVSWIEKLVRDELLR"
     MNPSPLHIES IGQGQEIIIL HGWGVNSAVF TPLHSSLSQY RVHYVDLPGF GHSSMIEGDI        60
     DAWVDAITSR LSHKAIWVGW SLGGLVATRA ALRYPERVQG LVTIASSPCF MAREEESWPG       120
     IPPQVLSDFS KQLGSDLSKT IDRFLAIQAM GSVTAKDDIK QLRELVLSRP LPETTALVQG       180
     LDMLKSVDLR PQIAQIEQPW LRIWGRLDGL IPRRVPPLMP KDEQLYQDLI LHRASHAPFI       240
     SHRDEFITGL VSWIEKLVRD ELLR                                              264
//

If you have problems or comments...

PBIL Back to PBIL home page