(data stored in ACNUC7421 zone)

EMBL: CP000821.PE177

CP000821.PE177       Location/Qualifiers
FT   CDS             201710..202510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0177"
FT                   /product="competence protein ComF"
FT                   /note="KEGG: shw:Sputw3181_0113 competence protein ComF"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34790"
FT                   /db_xref="GOA:A8FPL7"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPL7"
FT                   /protein_id="ABV34790.1"
FT                   /translation="MIKDSIAQRALTGLVKAAQFGRRRLQALYRGVVNLLAASLPNRCL
FT                   MCHQSIELPDSGICSVCLVTGLYQVPVCLGCGRAMQVEAIYCGACTSSRPLMIIAPCSY
FT                   HQGLGEWVGQMKYQTQFSALPVLSHVLANRILYLEEIGLLQLPQVLIPVPLHSNRLRKR
FT                   GFNQAYLIADALTGRLNIPVVTEGLTRTIDTCSQAGLTGKQRRKNLSGAFSLEAHFSYQ
FT                   RIALIDDVVTTGTTAIEIAELFEKRHIHVQIWCLARAEAPGLMD"
     MIKDSIAQRA LTGLVKAAQF GRRRLQALYR GVVNLLAASL PNRCLMCHQS IELPDSGICS        60
     VCLVTGLYQV PVCLGCGRAM QVEAIYCGAC TSSRPLMIIA PCSYHQGLGE WVGQMKYQTQ       120
     FSALPVLSHV LANRILYLEE IGLLQLPQVL IPVPLHSNRL RKRGFNQAYL IADALTGRLN       180
     IPVVTEGLTR TIDTCSQAGL TGKQRRKNLS GAFSLEAHFS YQRIALIDDV VTTGTTAIEI       240
     AELFEKRHIH VQIWCLARAE APGLMD                                            266
//

If you have problems or comments...

PBIL Back to PBIL home page