(data stored in ACNUC7421 zone)

EMBL: CP000821.PE179

CP000821.PE179       Location/Qualifiers
FT   CDS             205299..205877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0179"
FT                   /product="HesB/YadR/YfhF-family protein"
FT                   /note="KEGG: shm:Shewmr7_3880 HesB/YadR/YfhF-family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34792"
FT                   /db_xref="GOA:A8FPL9"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR001075"
FT                   /db_xref="InterPro:IPR017726"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8FPL9"
FT                   /protein_id="ABV34792.1"
FT                   /translation="MITISDAAQAHFVTLLADQPEGTHIRVFVISPGTATAECGVSYCP
FT                   PDAVEADDMEFEFNGFNAMVDEKSAPFLEEASIDFVTDQLGSQLTLKAPNAKMRKVASD
FT                   APLSERIDYVIQSEINPQLASHGGNIMLVEVTEEGTAILQFGGGCNGCSMVDVTLKDGI
FT                   ETQLLEKFPGELTGVKDVTEHQHGDHSYQ"
     MITISDAAQA HFVTLLADQP EGTHIRVFVI SPGTATAECG VSYCPPDAVE ADDMEFEFNG        60
     FNAMVDEKSA PFLEEASIDF VTDQLGSQLT LKAPNAKMRK VASDAPLSER IDYVIQSEIN       120
     PQLASHGGNI MLVEVTEEGT AILQFGGGCN GCSMVDVTLK DGIETQLLEK FPGELTGVKD       180
     VTEHQHGDHS YQ                                                           192
//

If you have problems or comments...

PBIL Back to PBIL home page