(data stored in ACNUC7421 zone)

EMBL: CP000821.PE180

CP000821.PE180       Location/Qualifiers
FT   CDS             complement(206370..207707)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0180"
FT                   /product="MATE efflux family protein"
FT                   /note="KEGG: sbl:Sbal_0144 MATE efflux family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34793"
FT                   /db_xref="GOA:A8FPM0"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPM0"
FT                   /protein_id="ABV34793.1"
FT                   /translation="MTPVELLRNRQKNRQLLALALPMILSNITVPLLGLVDTAVVGHLS
FT                   NAYYLGGVAVGSTIITLILWMLGFLRMATTGLVAQSFGAGDTQAQYKLLLQAGSLALIL
FT                   GLSAIVLQLPILNGALMLTDATAEVERYCREYFQIRIWSTPFALLNLVLLGWLLGRQQP
FT                   KAAMWQLIVANTVNIALDLLFVLGLDWGVKGAALASVFADISGFLVALMMVYKQVQKTG
FT                   GFDLFKLSKTLSLTSYHQLLSLNADIFIRSLCLQIAFAFMTFQGAGLGDNTVAANAVLL
FT                   NLLLLISYALDGIAYYAEAEVGRAYGQRNKALMRDSVTLAWLWSGISAILFTLLFAFGG
FT                   GAIINLLTSIEAVRLVAEQYLFWIIILPLLSFGSYLFDGVYIGAAMGKVMRNSMIISTF
FT                   GVFFPIWYLLQDMGNHALWAAMSAFMLARSMTLTLHYRYRLRNKGF"
     MTPVELLRNR QKNRQLLALA LPMILSNITV PLLGLVDTAV VGHLSNAYYL GGVAVGSTII        60
     TLILWMLGFL RMATTGLVAQ SFGAGDTQAQ YKLLLQAGSL ALILGLSAIV LQLPILNGAL       120
     MLTDATAEVE RYCREYFQIR IWSTPFALLN LVLLGWLLGR QQPKAAMWQL IVANTVNIAL       180
     DLLFVLGLDW GVKGAALASV FADISGFLVA LMMVYKQVQK TGGFDLFKLS KTLSLTSYHQ       240
     LLSLNADIFI RSLCLQIAFA FMTFQGAGLG DNTVAANAVL LNLLLLISYA LDGIAYYAEA       300
     EVGRAYGQRN KALMRDSVTL AWLWSGISAI LFTLLFAFGG GAIINLLTSI EAVRLVAEQY       360
     LFWIIILPLL SFGSYLFDGV YIGAAMGKVM RNSMIISTFG VFFPIWYLLQ DMGNHALWAA       420
     MSAFMLARSM TLTLHYRYRL RNKGF                                             445
//

If you have problems or comments...

PBIL Back to PBIL home page