(data stored in ACNUC7421 zone)

EMBL: CP000821.PE182

CP000821.PE182       Location/Qualifiers
FT   CDS             complement(208820..209857)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0182"
FT                   /product="Protein-glutamate methylesterase"
FT                   /EC_number="3.1.1.61"
FT                   /note="KEGG: slo:Shew_0109 response regulator receiver
FT                   modulated CheB methylesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34795"
FT                   /db_xref="GOA:A8FPM2"
FT                   /db_xref="InterPro:IPR000673"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR008248"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR035909"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPM2"
FT                   /protein_id="ABV34795.1"
FT                   /translation="MIKVLIVDDSPLVRQLLTHLLSDTSDISVVGAAEDPYEARELIKR
FT                   FNPDVLTLDIEMPKMDGIAFLRNLMKLRPMPVVMISTLTEKGAAVTLEALSIGAVDFIS
FT                   KPKSDLTNKLMEYRDELIEKVRFAAKSKVRPTSPIPAPKLCTSPTGCSQNQLIAIGAST
FT                   GGTEAIQRLICQLPSDVPPIVIAQHIPAAFSASFAKRLDSHASMRVIEAQGGELLKPGT
FT                   AYIAPGSAHLIIEKRGGLLYTRLLDSEPVNRHKPSVDVLFDSVAETAGKSALGVILTGM
FT                   GKDGAKGLLNMKQSGAYTLAQDEASSVVWGMPGAAVELDANCEELHIDRIPAKLLSVMK
FT                   NASQA"
     MIKVLIVDDS PLVRQLLTHL LSDTSDISVV GAAEDPYEAR ELIKRFNPDV LTLDIEMPKM        60
     DGIAFLRNLM KLRPMPVVMI STLTEKGAAV TLEALSIGAV DFISKPKSDL TNKLMEYRDE       120
     LIEKVRFAAK SKVRPTSPIP APKLCTSPTG CSQNQLIAIG ASTGGTEAIQ RLICQLPSDV       180
     PPIVIAQHIP AAFSASFAKR LDSHASMRVI EAQGGELLKP GTAYIAPGSA HLIIEKRGGL       240
     LYTRLLDSEP VNRHKPSVDV LFDSVAETAG KSALGVILTG MGKDGAKGLL NMKQSGAYTL       300
     AQDEASSVVW GMPGAAVELD ANCEELHIDR IPAKLLSVMK NASQA                       345
//

If you have problems or comments...

PBIL Back to PBIL home page