(data stored in ACNUC7421 zone)

EMBL: CP000821.PE183

CP000821.PE183       Location/Qualifiers
FT   CDS             complement(209961..210803)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0183"
FT                   /product="Protein-glutamate O-methyltransferase"
FT                   /EC_number="2.1.1.80"
FT                   /note="KEGG: saz:Sama_3498 protein-glutamate
FT                   O-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34796"
FT                   /db_xref="GOA:A8FPM3"
FT                   /db_xref="InterPro:IPR000780"
FT                   /db_xref="InterPro:IPR022641"
FT                   /db_xref="InterPro:IPR022642"
FT                   /db_xref="InterPro:IPR026024"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036804"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPM3"
FT                   /protein_id="ABV34796.1"
FT                   /translation="MTQADFDFIQSLAYEKTGIVLPERKKHMVYSRLSRRLRHLNLGNF
FT                   SQYCSHIQRTPDEMINFVNALTTNLTAFFREEHHFKYLESKVIPKWKKNKNRRLRVWSS
FT                   ACSTGEEPYSIAMILEQHFSGVEWDLKVLATDLDTDVLSKASIGSYASDSVTNLPRRYA
FT                   DKYARQTDNGQKVQMRSSVQKMIHFKQLNLLGEWPMKGPFDVIFCRNVLIYFDNETKKK
FT                   IIARFRKLLSPQGYLFIGHSETLTHISEDFDLIGQTIYRPIGHGDNKLQQTKRSVANL"
     MTQADFDFIQ SLAYEKTGIV LPERKKHMVY SRLSRRLRHL NLGNFSQYCS HIQRTPDEMI        60
     NFVNALTTNL TAFFREEHHF KYLESKVIPK WKKNKNRRLR VWSSACSTGE EPYSIAMILE       120
     QHFSGVEWDL KVLATDLDTD VLSKASIGSY ASDSVTNLPR RYADKYARQT DNGQKVQMRS       180
     SVQKMIHFKQ LNLLGEWPMK GPFDVIFCRN VLIYFDNETK KKIIARFRKL LSPQGYLFIG       240
     HSETLTHISE DFDLIGQTIY RPIGHGDNKL QQTKRSVANL                             280
//

If you have problems or comments...

PBIL Back to PBIL home page