(data stored in ACNUC7421 zone)

EMBL: CP000821.PE185

CP000821.PE185       Location/Qualifiers
FT   CDS             complement(213460..214011)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0185"
FT                   /product="CheW protein"
FT                   /note="KEGG: slo:Shew_0112 CheW protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34798"
FT                   /db_xref="GOA:A8FPM5"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR039315"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPM5"
FT                   /protein_id="ABV34798.1"
FT                   /translation="MTELTQQEQANMDDASQQYLTFIMASEEYGVDILSVQEIRGWEAT
FT                   TVIPNSPSHVKGVINLRGTIVPIIDLRQRFGIETLEYGATTVVIVVKVAMSDEHKVIGI
FT                   VVDAVSDVFSVNDADVRDAPDFGDDTNLSFIKGLTNAADKMVILLDINMLLGSEVLPEA
FT                   SQLSNLINNIDAQQPQAVNA"
     MTELTQQEQA NMDDASQQYL TFIMASEEYG VDILSVQEIR GWEATTVIPN SPSHVKGVIN        60
     LRGTIVPIID LRQRFGIETL EYGATTVVIV VKVAMSDEHK VIGIVVDAVS DVFSVNDADV       120
     RDAPDFGDDT NLSFIKGLTN AADKMVILLD INMLLGSEVL PEASQLSNLI NNIDAQQPQA       180
     VNA                                                                     183
//

If you have problems or comments...

PBIL Back to PBIL home page