(data stored in ACNUC7421 zone)

EMBL: CP000821.PE186

CP000821.PE186       Location/Qualifiers
FT   CDS             complement(214063..216129)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0186"
FT                   /product="CheA signal transduction histidine kinase"
FT                   /note="KEGG: slo:Shew_0113 CheA signal transduction
FT                   histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34799"
FT                   /db_xref="GOA:A8FPM6"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004105"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037006"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPM6"
FT                   /protein_id="ABV34799.1"
FT                   /translation="MEIDLSQFSQVFFEESLEGLESMESELLKLDVNEPEDESINTIFR
FT                   AAHSIKGGSATFGFSQVANYTHLLETLLDEIRDGRRQMTSEHQDMLLLSVDLLRNMIDA
FT                   LMRKTDFDDPLLSQLEKRFTSELEGAAEDIQDEDATQADAEQAPDEQLWHIDFQAGIDI
FT                   LRCGNDPLLMFTELRQLGELTVKLAEINHPDFGDIDPEACYLSWHLELITDQKIERLKE
FT                   VFEWVEDECTIHYSSSVIDTGETRELQGTSESPQASPVPESTQASTSTSDSLPAEVVKP
FT                   KIVSQAKSPEGGSIRVSIEKIDLLINMVGELVITQAMLGQIGQQDEIDEESLLSMKQGL
FT                   EQLASHTRDLQESVMQIRMLPISFAFNRFPRLVRDIGQQLGKKVDLILNGEDTELDKTV
FT                   MEKIVDPMVHLVRNSLDHGLETPEIRVSKGKPETGSITLNAFHQGGNIIIEIIDDGAGL
FT                   DTDRILQKARDKGLVAEDEELSTEAIHQLIFKAGFSTADAVSDLSGRGVGMDVVRRNIN
FT                   ELNGTIELKSTQDKGSRFTIRLPLTLAILDGQLVRIGHHTYVVPLVSIHESLQVEPQRI
FT                   NRISENHELVRLRDEYLPVIKVFQEFDHEADAIEIKDGLVMVVDSNNEKVGLLVDELLS
FT                   QQQVVIKSLEDNYSKVPGVSGATILGDGTVALIIDISGLVSLAGITNTNEHAA"
     MEIDLSQFSQ VFFEESLEGL ESMESELLKL DVNEPEDESI NTIFRAAHSI KGGSATFGFS        60
     QVANYTHLLE TLLDEIRDGR RQMTSEHQDM LLLSVDLLRN MIDALMRKTD FDDPLLSQLE       120
     KRFTSELEGA AEDIQDEDAT QADAEQAPDE QLWHIDFQAG IDILRCGNDP LLMFTELRQL       180
     GELTVKLAEI NHPDFGDIDP EACYLSWHLE LITDQKIERL KEVFEWVEDE CTIHYSSSVI       240
     DTGETRELQG TSESPQASPV PESTQASTST SDSLPAEVVK PKIVSQAKSP EGGSIRVSIE       300
     KIDLLINMVG ELVITQAMLG QIGQQDEIDE ESLLSMKQGL EQLASHTRDL QESVMQIRML       360
     PISFAFNRFP RLVRDIGQQL GKKVDLILNG EDTELDKTVM EKIVDPMVHL VRNSLDHGLE       420
     TPEIRVSKGK PETGSITLNA FHQGGNIIIE IIDDGAGLDT DRILQKARDK GLVAEDEELS       480
     TEAIHQLIFK AGFSTADAVS DLSGRGVGMD VVRRNINELN GTIELKSTQD KGSRFTIRLP       540
     LTLAILDGQL VRIGHHTYVV PLVSIHESLQ VEPQRINRIS ENHELVRLRD EYLPVIKVFQ       600
     EFDHEADAIE IKDGLVMVVD SNNEKVGLLV DELLSQQQVV IKSLEDNYSK VPGVSGATIL       660
     GDGTVALIID ISGLVSLAGI TNTNEHAA                                          688
//

If you have problems or comments...

PBIL Back to PBIL home page