(data stored in ACNUC7421 zone)

EMBL: CP000821.PE187

CP000821.PE187       Location/Qualifiers
FT   CDS             complement(216175..216537)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0187"
FT                   /product="response regulator receiver protein"
FT                   /note="KEGG: saz:Sama_3494 response regulator receiver
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34800"
FT                   /db_xref="GOA:A8FPM7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPM7"
FT                   /protein_id="ABV34800.1"
FT                   /translation="MKRILAVDDSASMRQMVGFTLKTAGFDVTEASNGDEALKVAQKGE
FT                   YDLVISDVNMPVMDGLTLIRNLRTLPAYKFTPLLMLTTESGTDKKQEGRSAGATGWIVK
FT                   PFNPDQLLATVRKVLG"
     MKRILAVDDS ASMRQMVGFT LKTAGFDVTE ASNGDEALKV AQKGEYDLVI SDVNMPVMDG        60
     LTLIRNLRTL PAYKFTPLLM LTTESGTDKK QEGRSAGATG WIVKPFNPDQ LLATVRKVLG       120
//

If you have problems or comments...

PBIL Back to PBIL home page