(data stored in ACNUC7421 zone)

EMBL: CP000821.PE188

CP000821.PE188       Location/Qualifiers
FT   CDS             complement(216534..216830)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0188"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: slo:Shew_0115 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34801"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPM8"
FT                   /protein_id="ABV34801.1"
FT                   /translation="MTDQTIKLDSELTIRNIQPIFARLSELLTHDKLLHIDVSQLSRVD
FT                   TAGAQLLYLFSQTCNARSLKVEWQGGQPELRSNLKSLGIVIPELQSDTQEKML"
     MTDQTIKLDS ELTIRNIQPI FARLSELLTH DKLLHIDVSQ LSRVDTAGAQ LLYLFSQTCN        60
     ARSLKVEWQG GQPELRSNLK SLGIVIPELQ SDTQEKML                                98
//

If you have problems or comments...

PBIL Back to PBIL home page