(data stored in ACNUC7421 zone)

EMBL: CP000821.PE189

CP000821.PE189       Location/Qualifiers
FT   CDS             complement(217009..217665)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0189"
FT                   /product="electron transport protein SCO1/SenC"
FT                   /note="KEGG: shw:Sputw3181_0125 electron transport protein
FT                   SCO1/SenC"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34802"
FT                   /db_xref="GOA:A8FPM9"
FT                   /db_xref="InterPro:IPR003782"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPM9"
FT                   /protein_id="ABV34802.1"
FT                   /translation="MNKRLTRVVAALLAVVIVGLGSFTALQFQSMSEEVSQIELSNSFV
FT                   YPTPKRLPQFKLMEQHGTSFTNADLKGKWSLFFIGYTSCPDVCPTTMAKLTAAYPELLE
FT                   SADIQVIFLSVDPQRDTQDKLLNYMDFFNPKFIALTGDHTQLFPLTRSLGFVYAMVGDG
FT                   ENYQIDHSASMALISPEGENIAIIKPKSSTPGTLPQITSQALISDIHQIIQRKNG"
     MNKRLTRVVA ALLAVVIVGL GSFTALQFQS MSEEVSQIEL SNSFVYPTPK RLPQFKLMEQ        60
     HGTSFTNADL KGKWSLFFIG YTSCPDVCPT TMAKLTAAYP ELLESADIQV IFLSVDPQRD       120
     TQDKLLNYMD FFNPKFIALT GDHTQLFPLT RSLGFVYAMV GDGENYQIDH SASMALISPE       180
     GENIAIIKPK SSTPGTLPQI TSQALISDIH QIIQRKNG                               218
//

If you have problems or comments...

PBIL Back to PBIL home page