(data stored in ACNUC7421 zone)

EMBL: CP000821.PE19

CP000821.PE19        Location/Qualifiers
FT   CDS             complement(24405..24845)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0019"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: she:Shewmr4_0012 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34632"
FT                   /db_xref="GOA:A8FP59"
FT                   /db_xref="InterPro:IPR005302"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="UniProtKB/TrEMBL:A8FP59"
FT                   /protein_id="ABV34632.1"
FT                   /translation="MKKLIGIGFKPIKQGPMTLVESANVTQTHGVEQDFFGRPGKRQIT
FT                   VMSKDQWQLVCAELDSPLPWTTRRANLLIEGHCFCAADQGKLLRIGKLTLEITGETDPC
FT                   KKMEIAHAGLEAALTPDWRGGVTCRVLNDAIINKGDLVQLLS"
     MKKLIGIGFK PIKQGPMTLV ESANVTQTHG VEQDFFGRPG KRQITVMSKD QWQLVCAELD        60
     SPLPWTTRRA NLLIEGHCFC AADQGKLLRI GKLTLEITGE TDPCKKMEIA HAGLEAALTP       120
     DWRGGVTCRV LNDAIINKGD LVQLLS                                            146
//

If you have problems or comments...

PBIL Back to PBIL home page