(data stored in ACNUC7421 zone)

EMBL: CP000821.PE192

CP000821.PE192       Location/Qualifiers
FT   CDS             complement(219698..220243)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0192"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: slo:Shew_0119 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34805"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPN2"
FT                   /protein_id="ABV34805.1"
FT                   /translation="MNSPKKSGAKPLIILLLVFLLPVVAAKIVLSMNLYHGGATNKGEL
FT                   LSPETSYASLAMENPRPHEWQILYLLPSDCDALCLDRLYILKQSHIALGREQNRVHTMI
FT                   LLTESSDISALKLHSFETVKASTAMINILNDQQMVIVDPLGSLVMRYSKVSGRAKQILQ
FT                   GKSLVSDLRKMLKLSRVG"
     MNSPKKSGAK PLIILLLVFL LPVVAAKIVL SMNLYHGGAT NKGELLSPET SYASLAMENP        60
     RPHEWQILYL LPSDCDALCL DRLYILKQSH IALGREQNRV HTMILLTESS DISALKLHSF       120
     ETVKASTAMI NILNDQQMVI VDPLGSLVMR YSKVSGRAKQ ILQGKSLVSD LRKMLKLSRV       180
     G                                                                       181
//

If you have problems or comments...

PBIL Back to PBIL home page