(data stored in ACNUC7421 zone)

EMBL: CP000821.PE193

CP000821.PE193       Location/Qualifiers
FT   CDS             complement(220444..221202)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0193"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shw:Sputw3181_0129 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34806"
FT                   /db_xref="GOA:A8FPN3"
FT                   /db_xref="InterPro:IPR002994"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPN3"
FT                   /protein_id="ABV34806.1"
FT                   /translation="MKTNNVFTRYPQLYLVGSRALLIIITVSLFLFLVKLGFWQLSRAE
FT                   EKELWQTQLTTRQAADSLSYAELLSLPEAESLTGYRLTVTAQPLAEQVFLLDNQVFNGR
FT                   VGYLALQLMEVTPDRPWLLVELGFIPATANRESLPAIKPITMSQSLTGRLYQKQSNPMS
FT                   SALMAEPGWPKRIQNLNVGEMRDLVNRPIAAAVLQPETIKGIDLPHPWKPIPLSAQKHR
FT                   GYALQWFSMAFAFAILVLFFIYSRKRRKNR"
     MKTNNVFTRY PQLYLVGSRA LLIIITVSLF LFLVKLGFWQ LSRAEEKELW QTQLTTRQAA        60
     DSLSYAELLS LPEAESLTGY RLTVTAQPLA EQVFLLDNQV FNGRVGYLAL QLMEVTPDRP       120
     WLLVELGFIP ATANRESLPA IKPITMSQSL TGRLYQKQSN PMSSALMAEP GWPKRIQNLN       180
     VGEMRDLVNR PIAAAVLQPE TIKGIDLPHP WKPIPLSAQK HRGYALQWFS MAFAFAILVL       240
     FFIYSRKRRK NR                                                           252
//

If you have problems or comments...

PBIL Back to PBIL home page