(data stored in ACNUC7421 zone)

EMBL: CP000821.PE195

CP000821.PE195       Location/Qualifiers
FT   CDS             complement(221470..222345)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0195"
FT                   /product="cytochrome c oxidase, subunit III"
FT                   /note="KEGG: slo:Shew_0122 cytochrome c oxidase, subunit
FT                   III"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34808"
FT                   /db_xref="GOA:A8FPN5"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR024791"
FT                   /db_xref="InterPro:IPR033945"
FT                   /db_xref="InterPro:IPR035973"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPN5"
FT                   /protein_id="ABV34808.1"
FT                   /translation="MTSKHEHYYVPAQSAWPIIGALGLFLIAFGAGSYVQQLKTDGGSG
FT                   GFILLAGIAVIIFMIFGWFRTVIAESMSGLYSKQMDRSFRQGMSWFIFSEVMFFAAFFG
FT                   ALLYARMIAVPWLGGDSNNAMTNEVLWPGFEAVWPLVMTPGGTQTEAMGWTGLPLYNTI
FT                   ILLTSSVTLHFAHVSLEKEKRSAIAIWLGITILLGMGFLVLQAEEYIHAYREMGLTLSS
FT                   GVYGNTFFLLTGFHGMHVTLGTVFLMVLFLRVLKGHFTPEKHFAFQAGSWYWHFVDVVW
FT                   LCLFIFVYVL"
     MTSKHEHYYV PAQSAWPIIG ALGLFLIAFG AGSYVQQLKT DGGSGGFILL AGIAVIIFMI        60
     FGWFRTVIAE SMSGLYSKQM DRSFRQGMSW FIFSEVMFFA AFFGALLYAR MIAVPWLGGD       120
     SNNAMTNEVL WPGFEAVWPL VMTPGGTQTE AMGWTGLPLY NTIILLTSSV TLHFAHVSLE       180
     KEKRSAIAIW LGITILLGMG FLVLQAEEYI HAYREMGLTL SSGVYGNTFF LLTGFHGMHV       240
     TLGTVFLMVL FLRVLKGHFT PEKHFAFQAG SWYWHFVDVV WLCLFIFVYV L                291
//

If you have problems or comments...

PBIL Back to PBIL home page