(data stored in ACNUC7421 zone)

EMBL: CP000821.PE196

CP000821.PE196       Location/Qualifiers
FT   CDS             complement(222342..222911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0196"
FT                   /product="cytochrome c oxidase assembly protein CtaG/Cox11"
FT                   /note="KEGG: slo:Shew_0123 cytochrome c oxidase assembly
FT                   protein CtaG/Cox11"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34809"
FT                   /db_xref="GOA:A8FPN6"
FT                   /db_xref="InterPro:IPR007533"
FT                   /db_xref="InterPro:IPR023471"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPN6"
FT                   /protein_id="ABV34809.1"
FT                   /translation="MAKNLANANRKLISWLIAAAIGMFGFGFALVPLYDVLCEQLGING
FT                   KTQSTASSYEPVTIDKNRTITVEFMAQIQSDLPWEFKPEVKRLRVHPGELVRTNFNAKN
FT                   LSMIELVGQAIPSVSPGQGAAYFNKTECFCFNQQRLTAKASAELPLIFYVDPDLPDSIT
FT                   TLTLSYTLYNITDREYVSVVEQGAAK"
     MAKNLANANR KLISWLIAAA IGMFGFGFAL VPLYDVLCEQ LGINGKTQST ASSYEPVTID        60
     KNRTITVEFM AQIQSDLPWE FKPEVKRLRV HPGELVRTNF NAKNLSMIEL VGQAIPSVSP       120
     GQGAAYFNKT ECFCFNQQRL TAKASAELPL IFYVDPDLPD SITTLTLSYT LYNITDREYV       180
     SVVEQGAAK                                                               189
//

If you have problems or comments...

PBIL Back to PBIL home page