(data stored in ACNUC7421 zone)

EMBL: CP000821.PE198

CP000821.PE198       Location/Qualifiers
FT   CDS             complement(224528..226102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0198"
FT                   /product="Cytochrome-c oxidase"
FT                   /EC_number="1.9.3.1"
FT                   /note="KEGG: slo:Shew_0125 cytochrome c oxidase, subunit
FT                   II"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34811"
FT                   /db_xref="GOA:A8FPN8"
FT                   /db_xref="InterPro:IPR001505"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR011759"
FT                   /db_xref="InterPro:IPR014222"
FT                   /db_xref="InterPro:IPR034210"
FT                   /db_xref="InterPro:IPR036257"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPN8"
FT                   /protein_id="ABV34811.1"
FT                   /translation="MKQKLYGLPALLFSPSILAADMPLNMTQGVTEISGRVYNLHMIIL
FT                   YICCAIGILVFGVMIYSMINHRKSRGAVAANFHESTKVEIAWTLVPFIILVLMAIPATK
FT                   TLIAMEDPSDADLTIKITGSQWKWHYSYFDHDLEFYSLLSTPREQIEGTEVKGENYLLE
FT                   VDKPLVLPVNKKVRFLMTSDDVIHSWWVPAFAVKKDANPGFINEAWTRIDKPGVYRGQC
FT                   AELCGKDHGFMPIVVEALSEVDFDKWVIAQKQQANNAEAEAKAALSKTLSMEELMAKGE
FT                   QIYLARCAACHQPNGAGLPGVFPSLIGSPITIGPVAAHVDIVVNGKPGTAMQAFAKQLN
FT                   ATEIAAVVTFERNAWGNDSGDTVQAADVSSGGSSSAASNDSSTAIPATLPASQPETEQV
FT                   KTAVAETASKVVEEVEAVVLDDLTMDELMAVGEKVYMTHCVACHQAAGTGLPGAFPSLV
FT                   GSPVITGPISGHLDVVINGKPGTAMQSFSSLLTPQQLAAVVTYERNAWGNNSGDTVQAS
FT                   DVVGHGN"
     MKQKLYGLPA LLFSPSILAA DMPLNMTQGV TEISGRVYNL HMIILYICCA IGILVFGVMI        60
     YSMINHRKSR GAVAANFHES TKVEIAWTLV PFIILVLMAI PATKTLIAME DPSDADLTIK       120
     ITGSQWKWHY SYFDHDLEFY SLLSTPREQI EGTEVKGENY LLEVDKPLVL PVNKKVRFLM       180
     TSDDVIHSWW VPAFAVKKDA NPGFINEAWT RIDKPGVYRG QCAELCGKDH GFMPIVVEAL       240
     SEVDFDKWVI AQKQQANNAE AEAKAALSKT LSMEELMAKG EQIYLARCAA CHQPNGAGLP       300
     GVFPSLIGSP ITIGPVAAHV DIVVNGKPGT AMQAFAKQLN ATEIAAVVTF ERNAWGNDSG       360
     DTVQAADVSS GGSSSAASND SSTAIPATLP ASQPETEQVK TAVAETASKV VEEVEAVVLD       420
     DLTMDELMAV GEKVYMTHCV ACHQAAGTGL PGAFPSLVGS PVITGPISGH LDVVINGKPG       480
     TAMQSFSSLL TPQQLAAVVT YERNAWGNNS GDTVQASDVV GHGN                        524
//

If you have problems or comments...

PBIL Back to PBIL home page