(data stored in ACNUC7421 zone)

EMBL: CP000821.PE199

CP000821.PE199       Location/Qualifiers
FT   CDS             complement(226521..227033)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0199"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sbl:Sbal_0155 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34812"
FT                   /db_xref="GOA:A8FPN9"
FT                   /db_xref="InterPro:IPR004596"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPN9"
FT                   /protein_id="ABV34812.1"
FT                   /translation="MNSLIGNSPRHPGLWVNLEDPLSNELQGCTVSSVTTHTQGRDELQ
FT                   MLSAQLASLSHRGQWIVLISPPNIGYKQMLTDAGVRMDRVLLVHAKDEVETLWAMEKAL
FT                   TSGTSSAVISWTQSLDARDNRRLQIVAKSARAVGIVIEVANGHLHGKAHMNGVEAFNQP
FT                   SLFGSLH"
     MNSLIGNSPR HPGLWVNLED PLSNELQGCT VSSVTTHTQG RDELQMLSAQ LASLSHRGQW        60
     IVLISPPNIG YKQMLTDAGV RMDRVLLVHA KDEVETLWAM EKALTSGTSS AVISWTQSLD       120
     ARDNRRLQIV AKSARAVGIV IEVANGHLHG KAHMNGVEAF NQPSLFGSLH                  170
//

If you have problems or comments...

PBIL Back to PBIL home page