(data stored in ACNUC7421 zone)

EMBL: CP000821.PE2

CP000821.PE2         Location/Qualifiers
FT   CDS             complement(1997..3631)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0002"
FT                   /product="60 kDa inner membrane insertion protein"
FT                   /note="KEGG: slo:Shew_3866 60 kDa inner membrane insertion
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34615"
FT                   /db_xref="GOA:A8FP42"
FT                   /db_xref="InterPro:IPR001708"
FT                   /db_xref="InterPro:IPR019998"
FT                   /db_xref="InterPro:IPR028053"
FT                   /db_xref="InterPro:IPR028055"
FT                   /db_xref="InterPro:IPR038210"
FT                   /db_xref="InterPro:IPR038221"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8FP42"
FT                   /protein_id="ABV34615.1"
FT                   /translation="MESQRNILLIGLLFVSFLLWQQWQTDQAPQPVAMESSSTIPSSST
FT                   SDSHSSDVPDADSALPAAVVASKELITVNTDQLIIKINPIGGDIVYSALVEHKLELDKD
FT                   EPFVLLEQTKDINYIAQSGLIGRNGIDSSSKGRAHFDSASREYTLASGQDTLEVPLTFV
FT                   ADNGATYTKMFVFHRGQFKVDVDYVIDNSTDQQLQVQMYGQIKHSIKQSESSMMMPTYR
FT                   GAAFSTANTRYEKYSFDDMADKNLDEKTLGGWAAMLQHYFVSAWVPPANDQNIIFSSIS
FT                   AGGQANIGFRGAVYDVAPGATQTINSEFYVGPKNQEALSAISESLNLVVDYGFLWWLAV
FT                   PIYKLLMFFQSLVTNWGLAIILITLTVRGMLYPLTKAQYTSMAKMRNLQPKLAEMKERF
FT                   GDDRQKMGQAMMELYKKEKVNPMGGCLPILLQMPIFIALYWVLLESVELRHAPFMLWIT
FT                   DLSVQDPYYVMPILMGISMFVMQKMQPMAPTMDPMQQKMMQWMPVVFTVFFLWFPAGLV
FT                   LYWLVGNLVAITQQKIIYAGLAKKGLK"
     MESQRNILLI GLLFVSFLLW QQWQTDQAPQ PVAMESSSTI PSSSTSDSHS SDVPDADSAL        60
     PAAVVASKEL ITVNTDQLII KINPIGGDIV YSALVEHKLE LDKDEPFVLL EQTKDINYIA       120
     QSGLIGRNGI DSSSKGRAHF DSASREYTLA SGQDTLEVPL TFVADNGATY TKMFVFHRGQ       180
     FKVDVDYVID NSTDQQLQVQ MYGQIKHSIK QSESSMMMPT YRGAAFSTAN TRYEKYSFDD       240
     MADKNLDEKT LGGWAAMLQH YFVSAWVPPA NDQNIIFSSI SAGGQANIGF RGAVYDVAPG       300
     ATQTINSEFY VGPKNQEALS AISESLNLVV DYGFLWWLAV PIYKLLMFFQ SLVTNWGLAI       360
     ILITLTVRGM LYPLTKAQYT SMAKMRNLQP KLAEMKERFG DDRQKMGQAM MELYKKEKVN       420
     PMGGCLPILL QMPIFIALYW VLLESVELRH APFMLWITDL SVQDPYYVMP ILMGISMFVM       480
     QKMQPMAPTM DPMQQKMMQW MPVVFTVFFL WFPAGLVLYW LVGNLVAITQ QKIIYAGLAK       540
     KGLK                                                                    544
//

If you have problems or comments...

PBIL Back to PBIL home page