(data stored in ACNUC7421 zone)

EMBL: CP000821.PE202

CP000821.PE202       Location/Qualifiers
FT   CDS             230224..231480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0202"
FT                   /product="aromatic amino acid transporter"
FT                   /note="KEGG: slo:Shew_3531 aromatic amino acid transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34815"
FT                   /db_xref="GOA:A8FPP2"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR013059"
FT                   /db_xref="InterPro:IPR018227"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPP2"
FT                   /protein_id="ABV34815.1"
FT                   /translation="MANHMNAAKDGAASKSLLGGAMIIAGTAVGAGMFSLPVVGAGMWF
FT                   SYSLVMMLGVWFCMLVSGLLLLETNLHFEPGDSFDTLTRETLGNFWRIVNGLSIAFVLY
FT                   ILAYAYISGGGSIVNHSLAAAGIELPQSLAGLVFALGLAFIVFISTKAVDRITTIMLGG
FT                   MIITFFLAVGNLLIEIDTVKLFTPDGESRYLPYMLAAIPFGLVSFGYHGNVPSLVKYYG
FT                   KDASTIIKAIVTGTLIAFVIYVCWLVATMGNIPRNDFVDIIAQGGNMGVLVSALSDVMS
FT                   SGWLTTMLTVFANLAVASSFLGVTLGLFDYLADLFGFDESRSGRFKTAAVTFLPPTVLG
FT                   LLFPNGFLIAIGFAALAATIWAAIVPAMMAYKARKLYPNSESFRVPGGTFVIAIVILFG
FT                   VVTGACHLLAMAELLPVYG"
     MANHMNAAKD GAASKSLLGG AMIIAGTAVG AGMFSLPVVG AGMWFSYSLV MMLGVWFCML        60
     VSGLLLLETN LHFEPGDSFD TLTRETLGNF WRIVNGLSIA FVLYILAYAY ISGGGSIVNH       120
     SLAAAGIELP QSLAGLVFAL GLAFIVFIST KAVDRITTIM LGGMIITFFL AVGNLLIEID       180
     TVKLFTPDGE SRYLPYMLAA IPFGLVSFGY HGNVPSLVKY YGKDASTIIK AIVTGTLIAF       240
     VIYVCWLVAT MGNIPRNDFV DIIAQGGNMG VLVSALSDVM SSGWLTTMLT VFANLAVASS       300
     FLGVTLGLFD YLADLFGFDE SRSGRFKTAA VTFLPPTVLG LLFPNGFLIA IGFAALAATI       360
     WAAIVPAMMA YKARKLYPNS ESFRVPGGTF VIAIVILFGV VTGACHLLAM AELLPVYG         418
//

If you have problems or comments...

PBIL Back to PBIL home page