(data stored in ACNUC7421 zone)

EMBL: CP000821.PE206

CP000821.PE206       Location/Qualifiers
FT   CDS             complement(234315..235505)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0206"
FT                   /product="GGDEF domain"
FT                   /note="KEGG: sdn:Sden_0245 GGDEF domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34819"
FT                   /db_xref="GOA:A8FPP6"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPP6"
FT                   /protein_id="ABV34819.1"
FT                   /translation="MSAFYHRCRYFFLPLLVTAFSLGLLQFTQANWQIWQGSINQLPFW
FT                   LLVTATALALQFNRSRLAYLATLLLLFYADKQHHLLPSSLSSYTEANFLGGAMIITCFS
FT                   FFKDRGLLSPHSLVRVFSIFLCFGMAYGWLWGIEHFQAEITAKSPLSLSFQFQAALPLY
FT                   LCGLLVLTRTLWQANLVNTSILITFVIWVLYDLTPGQLPLSVLLSALAVIFLFTILIDS
FT                   YFLAYRDELTGLASRRALYNLVLSLGRKYSVAMLDIDHFKKFNDTYGHDVGDQVLKLVA
FT                   AKMARVSGGGKVFRYGGEEFTIVFPRKDTDSVIDHLEDVRESIEEYRIVLRDDKRKRST
FT                   KAKRNAANKSNKKTVSVTISIGVAERLGGETFDQTLKQADEALYRAKKKGRNQICT"
     MSAFYHRCRY FFLPLLVTAF SLGLLQFTQA NWQIWQGSIN QLPFWLLVTA TALALQFNRS        60
     RLAYLATLLL LFYADKQHHL LPSSLSSYTE ANFLGGAMII TCFSFFKDRG LLSPHSLVRV       120
     FSIFLCFGMA YGWLWGIEHF QAEITAKSPL SLSFQFQAAL PLYLCGLLVL TRTLWQANLV       180
     NTSILITFVI WVLYDLTPGQ LPLSVLLSAL AVIFLFTILI DSYFLAYRDE LTGLASRRAL       240
     YNLVLSLGRK YSVAMLDIDH FKKFNDTYGH DVGDQVLKLV AAKMARVSGG GKVFRYGGEE       300
     FTIVFPRKDT DSVIDHLEDV RESIEEYRIV LRDDKRKRST KAKRNAANKS NKKTVSVTIS       360
     IGVAERLGGE TFDQTLKQAD EALYRAKKKG RNQICT                                 396
//

If you have problems or comments...

PBIL Back to PBIL home page