(data stored in ACNUC7421 zone)

EMBL: CP000821.PE208

CP000821.PE208       Location/Qualifiers
FT   CDS             236322..237110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0208"
FT                   /product="glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="KEGG: slo:Shew_3533 glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34821"
FT                   /db_xref="GOA:A8FPP8"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="InterPro:IPR041581"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPP8"
FT                   /protein_id="ABV34821.1"
FT                   /translation="MKVERYIQGQPCWIELASHDAKAGKQFYSELLGWGLQDMPIPDGV
FT                   YTMFNLALGEEIDEIGAAYQMHVETSEQGVPTNWTVYFAVDSVDTTIELVRTYGGELLL
FT                   GPHDVGTAGRMALLSDSEGAKFAIWQAGEHKGAGKRGEVGTLCWVELACRDSELAKQFY
FT                   PNILGWKAQPGDMPDFEYTEWLVDGQPFGSMMEMTEAWGDIAPHWMLYFTVADCDETAV
FT                   KAAKLGGKICVPPTTIPKVGRFAVINDPQGGFFSVIALNT"
     MKVERYIQGQ PCWIELASHD AKAGKQFYSE LLGWGLQDMP IPDGVYTMFN LALGEEIDEI        60
     GAAYQMHVET SEQGVPTNWT VYFAVDSVDT TIELVRTYGG ELLLGPHDVG TAGRMALLSD       120
     SEGAKFAIWQ AGEHKGAGKR GEVGTLCWVE LACRDSELAK QFYPNILGWK AQPGDMPDFE       180
     YTEWLVDGQP FGSMMEMTEA WGDIAPHWML YFTVADCDET AVKAAKLGGK ICVPPTTIPK       240
     VGRFAVINDP QGGFFSVIAL NT                                                262
//

If you have problems or comments...

PBIL Back to PBIL home page