(data stored in ACNUC7421 zone)

EMBL: CP000821.PE21

CP000821.PE21        Location/Qualifiers
FT   CDS             complement(25322..25789)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0021"
FT                   /product="YbaK/EbsC protein"
FT                   /note="KEGG: slo:Shew_0016 YbaK/EbsC protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34634"
FT                   /db_xref="GOA:A8FP61"
FT                   /db_xref="InterPro:IPR004369"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/TrEMBL:A8FP61"
FT                   /protein_id="ABV34634.1"
FT                   /translation="MTPAIDLLKKAHIKHTIHEYQHEASALAYGIEAATKLNLDAKLVF
FT                   KTLVAKLDSGKLVVAIIPVEEKLNMKALAKVAGVKKAAMASAEEVERSTGYVLGGVSPL
FT                   GQKRPLLTYIDTSAEQLDQLYVSGGKRGLDIELTPSALLKLTRALFAPLIV"
     MTPAIDLLKK AHIKHTIHEY QHEASALAYG IEAATKLNLD AKLVFKTLVA KLDSGKLVVA        60
     IIPVEEKLNM KALAKVAGVK KAAMASAEEV ERSTGYVLGG VSPLGQKRPL LTYIDTSAEQ       120
     LDQLYVSGGK RGLDIELTPS ALLKLTRALF APLIV                                  155
//

If you have problems or comments...

PBIL Back to PBIL home page