(data stored in ACNUC7421 zone)

EMBL: CP000821.PE211

CP000821.PE211       Location/Qualifiers
FT   CDS             complement(242600..244552)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0211"
FT                   /product="Membrane-fusion protein-like protein"
FT                   /note="KEGG: slo:Shew_3535 efflux transporter, RND family,
FT                   MFP subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34824"
FT                   /db_xref="GOA:A8FPQ1"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPQ1"
FT                   /protein_id="ABV34824.1"
FT                   /translation="MSHLESNNKRTKLAYLLSLFMVITPQLAHSQQLLAQENTAQHTEH
FT                   SHTDAKTATYSCPMHPDETSHEAGSRCSICNMFLVNEGVEEEEGRAKTSLSASEQKTYV
FT                   CPMHPDETSHEAGSRCSICNMFLVNEGVEEEEGGAKTNLSASEQKTYVCPMHPDETSHE
FT                   AGSRCSICNMFLVNEGVEEEEGGAKTSLTANEQKTYVCPMHPDETSHEAGSRCPICNMF
FT                   LVEEEEEEKGSVDHSSHNMSSSTPEDHSGHAHQTQEADTPADTVFNSAKPAPLDDGANI
FT                   KYVCPMHAHIISDVPGTCPICGMNLEKVELGGNSKEIQIDVSGGMQQALALKVARVEKD
FT                   TLWKFVQTVGQIDYDESKINHIHARVNGWIEKLTIESVGDKIIKGQLLYEIYSPDLINA
FT                   QDDFLLAQDTLKRSGSSENYKDLVRKAGLRLELLGFNKSQIKALAKSKKTQYRVPFYAK
FT                   SGGIVKALSVRDGMYIQPSTEVMSVVDLSKVWVIADVFENEQSWLEIGQKAEVSVPAMG
FT                   IKGIEGEIDYIYPELDAVTRSLRVRIVVKNKDLELRPNTLAKIDIFGGPNRDTLVIPQE
FT                   ALIQTGKENRVIVKLEDNSFTARKVTVGMLSQGKAEIKNGLEAGERVVTSGQFLLDSEA
FT                   SLKGSLMRLSSGHQH"
     MSHLESNNKR TKLAYLLSLF MVITPQLAHS QQLLAQENTA QHTEHSHTDA KTATYSCPMH        60
     PDETSHEAGS RCSICNMFLV NEGVEEEEGR AKTSLSASEQ KTYVCPMHPD ETSHEAGSRC       120
     SICNMFLVNE GVEEEEGGAK TNLSASEQKT YVCPMHPDET SHEAGSRCSI CNMFLVNEGV       180
     EEEEGGAKTS LTANEQKTYV CPMHPDETSH EAGSRCPICN MFLVEEEEEE KGSVDHSSHN       240
     MSSSTPEDHS GHAHQTQEAD TPADTVFNSA KPAPLDDGAN IKYVCPMHAH IISDVPGTCP       300
     ICGMNLEKVE LGGNSKEIQI DVSGGMQQAL ALKVARVEKD TLWKFVQTVG QIDYDESKIN       360
     HIHARVNGWI EKLTIESVGD KIIKGQLLYE IYSPDLINAQ DDFLLAQDTL KRSGSSENYK       420
     DLVRKAGLRL ELLGFNKSQI KALAKSKKTQ YRVPFYAKSG GIVKALSVRD GMYIQPSTEV       480
     MSVVDLSKVW VIADVFENEQ SWLEIGQKAE VSVPAMGIKG IEGEIDYIYP ELDAVTRSLR       540
     VRIVVKNKDL ELRPNTLAKI DIFGGPNRDT LVIPQEALIQ TGKENRVIVK LEDNSFTARK       600
     VTVGMLSQGK AEIKNGLEAG ERVVTSGQFL LDSEASLKGS LMRLSSGHQH                  650
//

If you have problems or comments...

PBIL Back to PBIL home page