(data stored in ACNUC7421 zone)

EMBL: CP000821.PE212

CP000821.PE212       Location/Qualifiers
FT   CDS             complement(244575..245153)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0212"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: slo:Shew_3536 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34825"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPQ2"
FT                   /protein_id="ABV34825.1"
FT                   /translation="MKTLLSLVLSVFILVSMVPAASAHQHEHAQHESADYACPMHPEVT
FT                   GQKGDSCPKCGMNLEANKATTSKHQGKKCDSCPNHKAKAHKDMHADTHACPMHPSVTGE
FT                   KGDTCPDCGMNLTASKAASQHHGKKCDSCPNHGAKAHKDMHADTHACPMNPKITGKKGD
FT                   TCPKCGMNLEPIKTAANGAGKHPAHHKQQ"
     MKTLLSLVLS VFILVSMVPA ASAHQHEHAQ HESADYACPM HPEVTGQKGD SCPKCGMNLE        60
     ANKATTSKHQ GKKCDSCPNH KAKAHKDMHA DTHACPMHPS VTGEKGDTCP DCGMNLTASK       120
     AASQHHGKKC DSCPNHGAKA HKDMHADTHA CPMNPKITGK KGDTCPKCGM NLEPIKTAAN       180
     GAGKHPAHHK QQ                                                           192
//

If you have problems or comments...

PBIL Back to PBIL home page