(data stored in ACNUC7421 zone)

EMBL: CP000821.PE213

CP000821.PE213       Location/Qualifiers
FT   CDS             complement(245418..245819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0213"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: slo:Shew_3537 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34826"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPQ3"
FT                   /protein_id="ABV34826.1"
FT                   /translation="MALLAMLSQGLMTNGFSMVRNAEAHEAMMSESHDSDMMSMGDGAN
FT                   CHSEQTSNTDHCCDNEQNEVLPGTAQNCCDGDGFCQGNCSHCLVISVTGTLFYAKSWPG
FT                   FSPSQLSMATQMPYFHSISLTTDLRPPIA"
     MALLAMLSQG LMTNGFSMVR NAEAHEAMMS ESHDSDMMSM GDGANCHSEQ TSNTDHCCDN        60
     EQNEVLPGTA QNCCDGDGFC QGNCSHCLVI SVTGTLFYAK SWPGFSPSQL SMATQMPYFH       120
     SISLTTDLRP PIA                                                          133
//

If you have problems or comments...

PBIL Back to PBIL home page