(data stored in ACNUC7421 zone)

EMBL: CP000821.PE214

CP000821.PE214       Location/Qualifiers
FT   CDS             complement(245985..246410)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0214"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sfr:Sfri_0591 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34827"
FT                   /db_xref="InterPro:IPR018635"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPQ4"
FT                   /protein_id="ABV34827.1"
FT                   /translation="MKTLITAVALTLASFTSIAASVSFPDSLVVTGINGEKRFDAHQPQ
FT                   LADGENLIQLRYHDIFEVNADDSGAWVKSEPLYLLVDFQGQQEYQAATPTINTEDEAYD
FT                   FIENPIITLEDAQGKNKTVALLTHQQLMAKVLLTRKN"
     MKTLITAVAL TLASFTSIAA SVSFPDSLVV TGINGEKRFD AHQPQLADGE NLIQLRYHDI        60
     FEVNADDSGA WVKSEPLYLL VDFQGQQEYQ AATPTINTED EAYDFIENPI ITLEDAQGKN       120
     KTVALLTHQQ LMAKVLLTRK N                                                 141
//

If you have problems or comments...

PBIL Back to PBIL home page