(data stored in ACNUC7421 zone)

EMBL: CP000821.PE215

CP000821.PE215       Location/Qualifiers
FT   CDS             complement(246604..247095)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0215"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: slo:Shew_3539 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34828"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPQ5"
FT                   /protein_id="ABV34828.1"
FT                   /translation="MVLIISLVGQFLLSPAMAMPSLLHAFSHSQMSLLSNSELSESELS
FT                   DSELMPAEAMTVVTNQTQPNNNLPANEDQAMTHGQQDCDMAMSGLSNHDGPTIDCDALC
FT                   EMMGAGNCASHCTSATGILTQPQISLISPETSGRVQSGSWSTQTVELSSSNPPPKFEQA
FT                   "
     MVLIISLVGQ FLLSPAMAMP SLLHAFSHSQ MSLLSNSELS ESELSDSELM PAEAMTVVTN        60
     QTQPNNNLPA NEDQAMTHGQ QDCDMAMSGL SNHDGPTIDC DALCEMMGAG NCASHCTSAT       120
     GILTQPQISL ISPETSGRVQ SGSWSTQTVE LSSSNPPPKF EQA                         163
//

If you have problems or comments...

PBIL Back to PBIL home page