(data stored in ACNUC7421 zone)

EMBL: CP000821.PE217

CP000821.PE217       Location/Qualifiers
FT   CDS             complement(248722..249012)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0217"
FT                   /product="protein of unknown function DUF1145"
FT                   /note="KEGG: shn:Shewana3_3974 protein of unknown function
FT                   DUF1145"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34830"
FT                   /db_xref="GOA:A8FPQ7"
FT                   /db_xref="InterPro:IPR009525"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPQ7"
FT                   /protein_id="ABV34830.1"
FT                   /translation="MKFVITTGKAVTLFAWLLMTYNLIMPFEGNIAIILYILLAITTFM
FT                   HCFQVVIFHTIFKSLLSLKKGDYFSVFIFGAFSLLQYRSKVMQNLGNAETR"
     MKFVITTGKA VTLFAWLLMT YNLIMPFEGN IAIILYILLA ITTFMHCFQV VIFHTIFKSL        60
     LSLKKGDYFS VFIFGAFSLL QYRSKVMQNL GNAETR                                  96
//

If you have problems or comments...

PBIL Back to PBIL home page