(data stored in ACNUC7421 zone)

EMBL: CP000821.PE219

CP000821.PE219       Location/Qualifiers
FT   CDS             250086..251708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0219"
FT                   /product="signal recognition particle-docking protein FtsY"
FT                   /note="KEGG: slo:Shew_3606 signal recognition
FT                   particle-docking protein FtsY"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34832"
FT                   /db_xref="GOA:A8FPQ9"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004390"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036225"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPQ9"
FT                   /protein_id="ABV34832.1"
FT                   /translation="MAKKGFFSWFRKDKSKDEVSAPEAEVVTESQDAVEAEALSEEQAK
FT                   QAEQARIEAEALALAEEQAEQARIEAEALALAEEQAKQAELARIEAEALALAEEQAKQA
FT                   EQARIEAEAAALAEEQAKQAEQARIEAEAAALAEEQAKQAEQARIEAEAAALAEEQAKQ
FT                   AELARIEAEAAALAEEQAKQAEQARIETEAAALAEEQAKQAELDAEQVAAEQETEKQPE
FT                   PQEKPTKEGFFARLKRGLKRTSENIGSGFVSLFSGKKIDDDLFEELEEQLLIADVGVET
FT                   TTRLIDSLTEQASRKQLKDGEALYEILRDEMQKTLEPVSIPLVPESADGPFVILMVGVN
FT                   GVGKTTTIGKLAKQYQAQGKSVMLAAGDTFRAAAVEQLQVWGQRNDIPVVAQHTGADSA
FT                   SVLFDALQAARARNIDILIADTAGRLQNKAHLMDELKKVIRVMKKQDESAPHEVMLTLD
FT                   ASTGQNAISQAELFKKAVGVTGITISKLDGTAKGGVIFAIADKFGIPIRHIGVGEQIDD
FT                   LRTFDAKDFVDALFTQESDENKS"
     MAKKGFFSWF RKDKSKDEVS APEAEVVTES QDAVEAEALS EEQAKQAEQA RIEAEALALA        60
     EEQAEQARIE AEALALAEEQ AKQAELARIE AEALALAEEQ AKQAEQARIE AEAAALAEEQ       120
     AKQAEQARIE AEAAALAEEQ AKQAEQARIE AEAAALAEEQ AKQAELARIE AEAAALAEEQ       180
     AKQAEQARIE TEAAALAEEQ AKQAELDAEQ VAAEQETEKQ PEPQEKPTKE GFFARLKRGL       240
     KRTSENIGSG FVSLFSGKKI DDDLFEELEE QLLIADVGVE TTTRLIDSLT EQASRKQLKD       300
     GEALYEILRD EMQKTLEPVS IPLVPESADG PFVILMVGVN GVGKTTTIGK LAKQYQAQGK       360
     SVMLAAGDTF RAAAVEQLQV WGQRNDIPVV AQHTGADSAS VLFDALQAAR ARNIDILIAD       420
     TAGRLQNKAH LMDELKKVIR VMKKQDESAP HEVMLTLDAS TGQNAISQAE LFKKAVGVTG       480
     ITISKLDGTA KGGVIFAIAD KFGIPIRHIG VGEQIDDLRT FDAKDFVDAL FTQESDENKS       540
//

If you have problems or comments...

PBIL Back to PBIL home page