(data stored in ACNUC7421 zone)

EMBL: CP000821.PE220

CP000821.PE220       Location/Qualifiers
FT   CDS             251738..252430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0220"
FT                   /product="cell division ATP-binding protein FtsE"
FT                   /note="KEGG: slo:Shew_3605 cell division ATP-binding
FT                   protein FtsE"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34833"
FT                   /db_xref="GOA:A8FPR0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005286"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPR0"
FT                   /protein_id="ABV34833.1"
FT                   /translation="MIRFEQVSKVYPGGQKALSDVNFHLKRGEMAFLTGHSGAGKSTLL
FT                   KLITVIERANAGRVLINGHDIAKLSRSDVPFLRRDIGMIFQSHHLLMEKSVFDNVALPL
FT                   VIEGFSHGEIKKRVLAALDMVGLYGKERHSPIMLSGGEQQRVGIARAIVNKPPLLLADE
FT                   PTGNLDPKLSMDILRLFETFNDSGTTVLIATHDLGLIARMKYRTLTLKQGHVLGGEELM
FT                   SSADGVKG"
     MIRFEQVSKV YPGGQKALSD VNFHLKRGEM AFLTGHSGAG KSTLLKLITV IERANAGRVL        60
     INGHDIAKLS RSDVPFLRRD IGMIFQSHHL LMEKSVFDNV ALPLVIEGFS HGEIKKRVLA       120
     ALDMVGLYGK ERHSPIMLSG GEQQRVGIAR AIVNKPPLLL ADEPTGNLDP KLSMDILRLF       180
     ETFNDSGTTV LIATHDLGLI ARMKYRTLTL KQGHVLGGEE LMSSADGVKG                  230
//

If you have problems or comments...

PBIL Back to PBIL home page