(data stored in ACNUC7421 zone)

EMBL: CP000821.PE221

CP000821.PE221       Location/Qualifiers
FT   CDS             252433..253398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0221"
FT                   /product="protein of unknown function DUF214"
FT                   /note="KEGG: slo:Shew_3604 protein of unknown function
FT                   DUF214"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34834"
FT                   /db_xref="GOA:A8FPR1"
FT                   /db_xref="InterPro:IPR004513"
FT                   /db_xref="InterPro:IPR040690"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPR1"
FT                   /protein_id="ABV34834.1"
FT                   /translation="MSNKPQLTRSKLPISGRIVMFFIRHIQHAMGSMGELWRNPVSSLM
FT                   TMAVLGVSLSLPAALQVLVKNAETITQSWNSAAEISLFVDEGRSERTIQSLITRIKVYP
FT                   EVSEVNYINRAQALEEFQRLSGFGEALSYLDTNPLPAVVTVTPSLKYSSPVGARELLKK
FT                   LEMEPEVSFGRLDIEWLERLQAVVRLLERTVLAIAALLVLAVVLVIGNTIRLAIMNRRT
FT                   EIEVMKLVGATEAFIQRPFLYTGIWYGIIGGVLAWIIINLLVWYLDSALAELLGLYGSQ
FT                   LEMQSLTLVELGQLVGLASFLGWLGSYLSVRQHLRAIEPS"
     MSNKPQLTRS KLPISGRIVM FFIRHIQHAM GSMGELWRNP VSSLMTMAVL GVSLSLPAAL        60
     QVLVKNAETI TQSWNSAAEI SLFVDEGRSE RTIQSLITRI KVYPEVSEVN YINRAQALEE       120
     FQRLSGFGEA LSYLDTNPLP AVVTVTPSLK YSSPVGAREL LKKLEMEPEV SFGRLDIEWL       180
     ERLQAVVRLL ERTVLAIAAL LVLAVVLVIG NTIRLAIMNR RTEIEVMKLV GATEAFIQRP       240
     FLYTGIWYGI IGGVLAWIII NLLVWYLDSA LAELLGLYGS QLEMQSLTLV ELGQLVGLAS       300
     FLGWLGSYLS VRQHLRAIEP S                                                 321
//

If you have problems or comments...

PBIL Back to PBIL home page