(data stored in ACNUC7421 zone)

EMBL: CP000821.PE222

CP000821.PE222       Location/Qualifiers
FT   CDS             253663..254520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0222"
FT                   /product="RNA polymerase, sigma 32 subunit, RpoH"
FT                   /note="KEGG: slo:Shew_3603 RNA polymerase, sigma 32
FT                   subunit, RpoH"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34835"
FT                   /db_xref="GOA:A8FPR2"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR012759"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPR2"
FT                   /protein_id="ABV34835.1"
FT                   /translation="MTNQTQSMALTVPHGSGSLEAYVHSAHNISMLQPEQEYELAKRLQ
FT                   ETGDLQAAKQLIMSHLRFVVHVAKGYSGYGLPQADLIQEGNIGLMKAVKRFDPNVGVRL
FT                   VSFAVHWIKAEIHEYVLKNWRIVKVATTKAQRKLFFNLRKSKKRLGWFSDEEVGMVADN
FT                   LGVSKADVTEMESRMAAQDPAFDLASDNDDDHDFAPMHYLEDHSSDLASQVENDNLEAS
FT                   NQARLLSAIKTLDERSQHILQARWLNEDKTTLQELAATYQVSAERIRQLEKNAMNKLKG
FT                   RMEA"
     MTNQTQSMAL TVPHGSGSLE AYVHSAHNIS MLQPEQEYEL AKRLQETGDL QAAKQLIMSH        60
     LRFVVHVAKG YSGYGLPQAD LIQEGNIGLM KAVKRFDPNV GVRLVSFAVH WIKAEIHEYV       120
     LKNWRIVKVA TTKAQRKLFF NLRKSKKRLG WFSDEEVGMV ADNLGVSKAD VTEMESRMAA       180
     QDPAFDLASD NDDDHDFAPM HYLEDHSSDL ASQVENDNLE ASNQARLLSA IKTLDERSQH       240
     ILQARWLNED KTTLQELAAT YQVSAERIRQ LEKNAMNKLK GRMEA                       285
//

If you have problems or comments...

PBIL Back to PBIL home page