(data stored in ACNUC7421 zone)

EMBL: CP000821.PE227

CP000821.PE227       Location/Qualifiers
FT   CDS             260780..261730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0227"
FT                   /product="cytochrome c family protein"
FT                   /note="KEGG: sfr:Sfri_3686 cytochrome c family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34840"
FT                   /db_xref="InterPro:IPR010177"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR020015"
FT                   /db_xref="InterPro:IPR023155"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPR7"
FT                   /protein_id="ABV34840.1"
FT                   /translation="MIYRVFYNLLCGVITVLCLSLSAHAVPWQNLTGEQLEQKLAEKFS
FT                   AGEYSSKGADSCLMCHRKDEAVMAIFDGTHGMMNSKQSPMAGLQCEACHGPQGKHNRGG
FT                   KEPMIAFGTDSKLSASAQNSVCQGCHNDPKQMAWHSSTHNLEEVACADCHTLHSAKDPA
FT                   LDKLSVNDTCSSCHTKEKADMNKRSSHPLKWDQMTCIDCHSPHGSMSESALNKPTINDT
FT                   CYSCHSEKRGPVLWEHAPVTENCVTCHNPHGSVNEGMLKSRAPQLCQQCHAPDGHASRV
FT                   VQEPGMDAFGGGKSCLNCHSKIHGSNHPSGSLLQR"
     MIYRVFYNLL CGVITVLCLS LSAHAVPWQN LTGEQLEQKL AEKFSAGEYS SKGADSCLMC        60
     HRKDEAVMAI FDGTHGMMNS KQSPMAGLQC EACHGPQGKH NRGGKEPMIA FGTDSKLSAS       120
     AQNSVCQGCH NDPKQMAWHS STHNLEEVAC ADCHTLHSAK DPALDKLSVN DTCSSCHTKE       180
     KADMNKRSSH PLKWDQMTCI DCHSPHGSMS ESALNKPTIN DTCYSCHSEK RGPVLWEHAP       240
     VTENCVTCHN PHGSVNEGML KSRAPQLCQQ CHAPDGHASR VVQEPGMDAF GGGKSCLNCH       300
     SKIHGSNHPS GSLLQR                                                       316
//

If you have problems or comments...

PBIL Back to PBIL home page