(data stored in ACNUC7421 zone)

EMBL: CP000821.PE228

CP000821.PE228       Location/Qualifiers
FT   CDS             261745..263754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0228"
FT                   /product="outer membrane protein"
FT                   /note="KEGG: sfr:Sfri_3685 outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34841"
FT                   /db_xref="InterPro:IPR020016"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPR8"
FT                   /protein_id="ABV34841.1"
FT                   /translation="MGFKLNIITVSLLAVSGSAMATNFGVGNANTDSINMDKYQCKRCV
FT                   STNGYIGEVSVSAGYNSVDDIHAGNALGSAEDGAIAAVSGDIRYQNETGYRAQIQAHQL
FT                   GMDNGFANIKVGKSGLYELELDYQSLKSYQAGDVQSQLWHDDGMLTPSSYTNEFDLALK
FT                   REKSAIGFNYGEGFYNTFIRYSQEEKTGHQSSSLVAPSPVNFGLPVDATTKQLDAGASL
FT                   AGDNWLTELSYFGSYYGNNIKDLSLPHMNDVYSATPDNEAHQVSLSGQYQFNRTVMSGR
FT                   LVTGRMIQDDALIQMSGNPLQSWDGQIDTLDGRFAVTSMLSNRLRLGGSVDYSKRDNKS
FT                   SVWEFTQYSYNGLSGSFKQNVPQDIERNTYKVNASYRIASGYRLQAGYDRKEVDRSYSE
FT                   REQTNEDSLWAKFNVSAFDTFKVNLKASHGNRGGSDYEVDEVTSSQENALMRKYYLADR
FT                   KRNAVELKVNHSPLSWMSIDVTGRYAKDDYDATEIGLTESEDFGYDVNLSLQFSKHLSA
FT                   YGFAGQQWINSAQAGSQSFSSPDWNADIEDEFINIGAGFSYGGLMQDKLTLGGDYLFSN
FT                   SISDTSVGGTLVTTNGSQPYGDYFSYNHSVRMYADYALSKQMALKLSYQYERYYDTDAA
FT                   QVATNAVPGLTTLGELNHDYNAHEVMLSFSYLLR"
     MGFKLNIITV SLLAVSGSAM ATNFGVGNAN TDSINMDKYQ CKRCVSTNGY IGEVSVSAGY        60
     NSVDDIHAGN ALGSAEDGAI AAVSGDIRYQ NETGYRAQIQ AHQLGMDNGF ANIKVGKSGL       120
     YELELDYQSL KSYQAGDVQS QLWHDDGMLT PSSYTNEFDL ALKREKSAIG FNYGEGFYNT       180
     FIRYSQEEKT GHQSSSLVAP SPVNFGLPVD ATTKQLDAGA SLAGDNWLTE LSYFGSYYGN       240
     NIKDLSLPHM NDVYSATPDN EAHQVSLSGQ YQFNRTVMSG RLVTGRMIQD DALIQMSGNP       300
     LQSWDGQIDT LDGRFAVTSM LSNRLRLGGS VDYSKRDNKS SVWEFTQYSY NGLSGSFKQN       360
     VPQDIERNTY KVNASYRIAS GYRLQAGYDR KEVDRSYSER EQTNEDSLWA KFNVSAFDTF       420
     KVNLKASHGN RGGSDYEVDE VTSSQENALM RKYYLADRKR NAVELKVNHS PLSWMSIDVT       480
     GRYAKDDYDA TEIGLTESED FGYDVNLSLQ FSKHLSAYGF AGQQWINSAQ AGSQSFSSPD       540
     WNADIEDEFI NIGAGFSYGG LMQDKLTLGG DYLFSNSISD TSVGGTLVTT NGSQPYGDYF       600
     SYNHSVRMYA DYALSKQMAL KLSYQYERYY DTDAAQVATN AVPGLTTLGE LNHDYNAHEV       660
     MLSFSYLLR                                                               669
//

If you have problems or comments...

PBIL Back to PBIL home page