(data stored in ACNUC7421 zone)

EMBL: CP000821.PE229

CP000821.PE229       Location/Qualifiers
FT   CDS             263789..266305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0229"
FT                   /product="anaerobic dimethyl sulfoxide reductase, A
FT                   subunit, DmsA/YnfE family"
FT                   /note="KEGG: spc:Sputcn32_0627 anaerobic dimethyl sulfoxide
FT                   reductase, A subunit, DmsA/YnfE family"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34842"
FT                   /db_xref="GOA:A8FPR9"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR011888"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="InterPro:IPR027467"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPR9"
FT                   /protein_id="ABV34842.1"
FT                   /translation="MERRSFLKMSAAMGCAASVTGCKTSSDDANVVPPQPPVGEEQITW
FT                   SSCLVNCGSNCPVKVFSRDGVITRVETDHDVADGDDVYQVRACARGRSLRQRTYAVDRL
FT                   KTPMKRVGKRGEGKFVPISWDEAAKTIGTKLTSVIAEHGNKAIFRSYGSGAYYGFASNA
FT                   CFNRLFNLNGGCLNAYGNYSWAQQMEAAKHTFGTGSTSGSSTVTLANSDFLLGVAYNPS
FT                   EIRQSGSGEGYDYLKALQKSNGLKVVMIDPRYTDSMLGKESKWLPIRPGTDAAFAEAIA
FT                   YQMISSGWVDQNSLSFINKYAVGFDAASITAQKELFANSGDATKQEYAKVMKPEENYRD
FT                   YILSQGVYADQPLKTSEWAEKITGIPAAQLEQIATDLQNAKAPYIVVGAGVNRQANGEQ
FT                   SMRALYMLSVLTGKLGTLGASNGELPSMSGMYRAGIPTGSNPVKESISFFTWSEAIHNG
FT                   ETMTARSHGVRGTDGLDTPLGTNIKVIISASDSSLLNQHAEINNTAKILEDETGVELIV
FT                   SCDCWMTPGAKFADIILPDTSWLESNDLVNDSYASGALGYITAMKSAIEPMWDCKSMYE
FT                   ASALIAKYMGCEAEFTEGKTEEQWLEELYQKTKDSSTNLGVVPAFPATYKEAQEIGFFR
FT                   KNMNDNHVALKSYINGGKALSTPSGKIEIYSAELAWRAANWDQELTTDVKGDTITAIPQ
FT                   YTVTWDGYEDEDTSTDYPIQLAGYHTKGRTHSSYHNVPWLREAVEDAVWVNPMDAAENG
FT                   LSAGDKIEMYNERGSIAVKVRITPRVAPGVFALGQGAWFKPGNTVGSTGHIIDEGGAIN
FT                   TLTRYQPSPVAKGNPQHTNRVAIKKI"
     MERRSFLKMS AAMGCAASVT GCKTSSDDAN VVPPQPPVGE EQITWSSCLV NCGSNCPVKV        60
     FSRDGVITRV ETDHDVADGD DVYQVRACAR GRSLRQRTYA VDRLKTPMKR VGKRGEGKFV       120
     PISWDEAAKT IGTKLTSVIA EHGNKAIFRS YGSGAYYGFA SNACFNRLFN LNGGCLNAYG       180
     NYSWAQQMEA AKHTFGTGST SGSSTVTLAN SDFLLGVAYN PSEIRQSGSG EGYDYLKALQ       240
     KSNGLKVVMI DPRYTDSMLG KESKWLPIRP GTDAAFAEAI AYQMISSGWV DQNSLSFINK       300
     YAVGFDAASI TAQKELFANS GDATKQEYAK VMKPEENYRD YILSQGVYAD QPLKTSEWAE       360
     KITGIPAAQL EQIATDLQNA KAPYIVVGAG VNRQANGEQS MRALYMLSVL TGKLGTLGAS       420
     NGELPSMSGM YRAGIPTGSN PVKESISFFT WSEAIHNGET MTARSHGVRG TDGLDTPLGT       480
     NIKVIISASD SSLLNQHAEI NNTAKILEDE TGVELIVSCD CWMTPGAKFA DIILPDTSWL       540
     ESNDLVNDSY ASGALGYITA MKSAIEPMWD CKSMYEASAL IAKYMGCEAE FTEGKTEEQW       600
     LEELYQKTKD SSTNLGVVPA FPATYKEAQE IGFFRKNMND NHVALKSYIN GGKALSTPSG       660
     KIEIYSAELA WRAANWDQEL TTDVKGDTIT AIPQYTVTWD GYEDEDTSTD YPIQLAGYHT       720
     KGRTHSSYHN VPWLREAVED AVWVNPMDAA ENGLSAGDKI EMYNERGSIA VKVRITPRVA       780
     PGVFALGQGA WFKPGNTVGS TGHIIDEGGA INTLTRYQPS PVAKGNPQHT NRVAIKKI         838
//

If you have problems or comments...

PBIL Back to PBIL home page