(data stored in ACNUC7421 zone)

EMBL: CP000821.PE23

CP000821.PE23        Location/Qualifiers
FT   CDS             complement(27258..29408)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0023"
FT                   /product="fatty oxidation complex, alpha subunit FadB"
FT                   /note="KEGG: shn:Shewana3_0024 fatty oxidation complex,
FT                   alpha subunit FadB"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34636"
FT                   /db_xref="GOA:A8FP63"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR006180"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR012799"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8FP63"
FT                   /protein_id="ABV34636.1"
FT                   /translation="MIYQSPTIQVELLEDNIARLCFNASGSVNKLDRETINSLDAALDA
FT                   IQQDSHIQALVLTSAKGAFIVGADITEFLGLFAQEDSVLLPWIAEANVVFNKLEDLPFP
FT                   TISAINGFALGGGFETVLATDFRIADTTAKIGLPETKLGLIPGFGGTVRLPRLIGTDNA
FT                   LEWITSGKDQRPEAALKVGAIDAVVAPENLQASAIKMLKDALAEKLDWQSRRARKQAAL
FT                   TLPKLEAMMSFATAKGMVFKIAGKHYPAPMAAISVIEQAARCGRADALKVEHQAFVKLA
FT                   KTDVAQALIGIFLNDQLVKGKAKKAGKLAKNIDTAAVLGAGIMGGGIAYQSASKGTPII
FT                   MKDIAQPALELGLGEASKLLAAQIKRGRSTPQKMAKVLNNITATLDYTPVKDVDVVVEA
FT                   VVEHPKVKSMVLAEVEQNVSDDAIITSNTSTISINLLAKSLKKPERFCGMHFFNPVHKM
FT                   PLVEVIRGENSSEETIASVVAYASKMGKTPIVVNDCPGFFVNRVLFPYFAGFSGLLADG
FT                   ADFAAIDKVMEKQFGWPMGPAYLLDVVGIDTGHHAQAVMAEGFPDRMGKNGKDAIDIMF
FT                   EAERFGQKNSKGFYAYSVDRRGKPKKDVDPTSYELLGAEFGELKAFESEDIIARTMIPM
FT                   IIETVRCLEEGIIATPAEADMGLVFGLGFPPFRGGVFRYIDTMGVANFVALADKYAHLG
FT                   GLYQVTDAMRELAANNGSYYQS"
     MIYQSPTIQV ELLEDNIARL CFNASGSVNK LDRETINSLD AALDAIQQDS HIQALVLTSA        60
     KGAFIVGADI TEFLGLFAQE DSVLLPWIAE ANVVFNKLED LPFPTISAIN GFALGGGFET       120
     VLATDFRIAD TTAKIGLPET KLGLIPGFGG TVRLPRLIGT DNALEWITSG KDQRPEAALK       180
     VGAIDAVVAP ENLQASAIKM LKDALAEKLD WQSRRARKQA ALTLPKLEAM MSFATAKGMV       240
     FKIAGKHYPA PMAAISVIEQ AARCGRADAL KVEHQAFVKL AKTDVAQALI GIFLNDQLVK       300
     GKAKKAGKLA KNIDTAAVLG AGIMGGGIAY QSASKGTPII MKDIAQPALE LGLGEASKLL       360
     AAQIKRGRST PQKMAKVLNN ITATLDYTPV KDVDVVVEAV VEHPKVKSMV LAEVEQNVSD       420
     DAIITSNTST ISINLLAKSL KKPERFCGMH FFNPVHKMPL VEVIRGENSS EETIASVVAY       480
     ASKMGKTPIV VNDCPGFFVN RVLFPYFAGF SGLLADGADF AAIDKVMEKQ FGWPMGPAYL       540
     LDVVGIDTGH HAQAVMAEGF PDRMGKNGKD AIDIMFEAER FGQKNSKGFY AYSVDRRGKP       600
     KKDVDPTSYE LLGAEFGELK AFESEDIIAR TMIPMIIETV RCLEEGIIAT PAEADMGLVF       660
     GLGFPPFRGG VFRYIDTMGV ANFVALADKY AHLGGLYQVT DAMRELAANN GSYYQS           716
//

If you have problems or comments...

PBIL Back to PBIL home page