(data stored in ACNUC7421 zone)

EMBL: CP000821.PE230

CP000821.PE230       Location/Qualifiers
FT   CDS             266320..266997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0230"
FT                   /product="anaerobic dimethyl sulfoxide reductase, B
FT                   subunit"
FT                   /note="KEGG: son:SO1430 anaerobic dimethyl sulfoxide
FT                   reductase, B subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34843"
FT                   /db_xref="InterPro:IPR014297"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPS0"
FT                   /protein_id="ABV34843.1"
FT                   /translation="MTQPTQYGFYVDSTKCSGCKACHVSCKDRQSNEIRNNSNPEGNAL
FT                   PALEGVTWRRVYEYGGGEWTKGNNGCFEQNVFAYYMSIGCNHCSEPVCVKACPTGAMHK
FT                   RREDGLVHVAQELCIGCESCARACPYDAPQIDRERKVMTKCDGCFERIAEGRKPVCVES
FT                   CPLRALDFDTMDNLRAKYGDGDGHIAPLPSPSITSPNLIIKANVNGRPAGSGEGQILNL
FT                   SEV"
     MTQPTQYGFY VDSTKCSGCK ACHVSCKDRQ SNEIRNNSNP EGNALPALEG VTWRRVYEYG        60
     GGEWTKGNNG CFEQNVFAYY MSIGCNHCSE PVCVKACPTG AMHKRREDGL VHVAQELCIG       120
     CESCARACPY DAPQIDRERK VMTKCDGCFE RIAEGRKPVC VESCPLRALD FDTMDNLRAK       180
     YGDGDGHIAP LPSPSITSPN LIIKANVNGR PAGSGEGQIL NLSEV                       225
//

If you have problems or comments...

PBIL Back to PBIL home page