(data stored in ACNUC7421 zone)

EMBL: CP000821.PE231

CP000821.PE231       Location/Qualifiers
FT   CDS             267075..267734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0231"
FT                   /product="cytoplasmic chaperone TorD family protein"
FT                   /note="KEGG: sfr:Sfri_3682 cytoplasmic chaperone TorD
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34844"
FT                   /db_xref="InterPro:IPR020945"
FT                   /db_xref="InterPro:IPR036411"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPS1"
FT                   /protein_id="ABV34844.1"
FT                   /translation="MPSINTFDFQAGQGIARILHNVLLSYPTGELLNNFKQYEVVETWP
FT                   EFGQSQDNQTGKAALSRYLSLYSDEQLDELKLDYGQLFFGPEEPKAMPWGSVYLGEAQL
FT                   LNDRSTLDLIAFYKQQGIEFELEYNQPQDHIALFFSVIDRLLGLLVENPDDESVRRTLS
FT                   VLLQHHMLPWSHRCLELAIEHSQTDFYSGIAHLALDFQKVLAEVFQVIPMPVRLYR"
     MPSINTFDFQ AGQGIARILH NVLLSYPTGE LLNNFKQYEV VETWPEFGQS QDNQTGKAAL        60
     SRYLSLYSDE QLDELKLDYG QLFFGPEEPK AMPWGSVYLG EAQLLNDRST LDLIAFYKQQ       120
     GIEFELEYNQ PQDHIALFFS VIDRLLGLLV ENPDDESVRR TLSVLLQHHM LPWSHRCLEL       180
     AIEHSQTDFY SGIAHLALDF QKVLAEVFQV IPMPVRLYR                              219
//

If you have problems or comments...

PBIL Back to PBIL home page