(data stored in ACNUC7421 zone)

EMBL: CP000821.PE232

CP000821.PE232       Location/Qualifiers
FT   CDS             267775..268251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0232"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sfr:Sfri_3125 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34845"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPS2"
FT                   /protein_id="ABV34845.1"
FT                   /translation="MSVIKAFGQQHTKAEFAYLLQGYLSQSAEVCELFTGATNMTTVVN
FT                   LIAALSYRESDERFAVTSLDTELVFSVLFDGFHLLFIKEVQHGSLNQAEHLILRLTQYY
FT                   AAKLEADFVPELTDGSRTEQHLELRNKLKQVLIASSQLDDLYLQRRGMQSNMGR"
     MSVIKAFGQQ HTKAEFAYLL QGYLSQSAEV CELFTGATNM TTVVNLIAAL SYRESDERFA        60
     VTSLDTELVF SVLFDGFHLL FIKEVQHGSL NQAEHLILRL TQYYAAKLEA DFVPELTDGS       120
     RTEQHLELRN KLKQVLIASS QLDDLYLQRR GMQSNMGR                               158
//

If you have problems or comments...

PBIL Back to PBIL home page