(data stored in ACNUC7421 zone)

EMBL: CP000821.PE233

CP000821.PE233       Location/Qualifiers
FT   CDS             complement(268291..269031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0233"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: son:SO1415 transcriptional regulator, TetR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34846"
FT                   /db_xref="GOA:A8FPS3"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPS3"
FT                   /protein_id="ABV34846.1"
FT                   /translation="MANRTSLKRQRISAILDSAEKAIVENGLFSLSLLELARQSGCSVN
FT                   TLYNYFSNREDIAVSLFNRYIGKWGVQASREISQHRYSFAERFLAMQMIWVYRQHRDID
FT                   EGGVQFLAAIPCVWKHASHQRISTTRQLLDTWFTLNREFLMMAREQGEMTASDAQIDEC
FT                   LLMVSITERGFSLLANNYLFRENIINMPLSKIFDSMNEELKQLEWKTAISDSSFNRVLE
FT                   LVTHVNEQLSDHHIDNLIYDIEDK"
     MANRTSLKRQ RISAILDSAE KAIVENGLFS LSLLELARQS GCSVNTLYNY FSNREDIAVS        60
     LFNRYIGKWG VQASREISQH RYSFAERFLA MQMIWVYRQH RDIDEGGVQF LAAIPCVWKH       120
     ASHQRISTTR QLLDTWFTLN REFLMMAREQ GEMTASDAQI DECLLMVSIT ERGFSLLANN       180
     YLFRENIINM PLSKIFDSMN EELKQLEWKT AISDSSFNRV LELVTHVNEQ LSDHHIDNLI       240
     YDIEDK                                                                  246
//

If you have problems or comments...

PBIL Back to PBIL home page