(data stored in ACNUC7421 zone)

EMBL: CP000821.PE234

CP000821.PE234       Location/Qualifiers
FT   CDS             269290..269898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0234"
FT                   /product="thiol:disulfide interchange protein, DsbA family"
FT                   /note="KEGG: son:SO3871 thiol:disulfide interchange
FT                   protein, DsbA family"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34847"
FT                   /db_xref="GOA:A8FPS4"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR023205"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPS4"
FT                   /protein_id="ABV34847.1"
FT                   /translation="MIKLLSTAAILLSFGASAASFTQGEHYVDLGEAAFNAPNQVTKVY
FT                   SVNCPFCYKYEKAVIPGFVKNLPDGVSFDSYHITTKPPFGKEKATVIAVAKVLGDKQYK
FT                   TAKMAYYKHIHDDKKKFSSAEDAISFGLKAAKIDSVTFSAHKDTSEVKALLTQWDQGVA
FT                   VAKVRGIPAIVVNGKYLINTKTITSMTMLDELTAELLEK"
     MIKLLSTAAI LLSFGASAAS FTQGEHYVDL GEAAFNAPNQ VTKVYSVNCP FCYKYEKAVI        60
     PGFVKNLPDG VSFDSYHITT KPPFGKEKAT VIAVAKVLGD KQYKTAKMAY YKHIHDDKKK       120
     FSSAEDAISF GLKAAKIDSV TFSAHKDTSE VKALLTQWDQ GVAVAKVRGI PAIVVNGKYL       180
     INTKTITSMT MLDELTAELL EK                                                202
//

If you have problems or comments...

PBIL Back to PBIL home page