(data stored in ACNUC7421 zone)

EMBL: CP000821.PE235

CP000821.PE235       Location/Qualifiers
FT   CDS             269907..270542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0235"
FT                   /product="disulfide bond formation protein"
FT                   /note="KEGG: son:SO3870 disulfide bond formation protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34848"
FT                   /db_xref="GOA:A8FPS5"
FT                   /db_xref="InterPro:IPR003752"
FT                   /db_xref="InterPro:IPR023380"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPS5"
FT                   /protein_id="ABV34848.1"
FT                   /translation="MNAISQGWQDLKTAPVSTLQQWQEQRWIWLLMSGAAAFLIGSAMG
FT                   YFQWFLEMDPCEICVYIRFSQFCILFAGLVIAINPNQVLLKVLGLTLAWYGVVQGMMWS
FT                   IDLSMLHDASHAMDDVMAGGGDLFAAGGGGGACSTEPTFPLGLPLHEWFPYEFQPSGIC
FT                   GEDDWSLLGLNMAQYCIIAYSVFGIALSAVTFGWISRLTQGHSSVKAH"
     MNAISQGWQD LKTAPVSTLQ QWQEQRWIWL LMSGAAAFLI GSAMGYFQWF LEMDPCEICV        60
     YIRFSQFCIL FAGLVIAINP NQVLLKVLGL TLAWYGVVQG MMWSIDLSML HDASHAMDDV       120
     MAGGGDLFAA GGGGGACSTE PTFPLGLPLH EWFPYEFQPS GICGEDDWSL LGLNMAQYCI       180
     IAYSVFGIAL SAVTFGWISR LTQGHSSVKA H                                      211
//

If you have problems or comments...

PBIL Back to PBIL home page