(data stored in ACNUC7421 zone)

EMBL: CP000821.PE236

CP000821.PE236       Location/Qualifiers
FT   CDS             270603..271346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0236"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vfi:VF0719 putative sugar hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34849"
FT                   /db_xref="GOA:A8FPS6"
FT                   /db_xref="InterPro:IPR018013"
FT                   /db_xref="InterPro:IPR036777"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPS6"
FT                   /protein_id="ABV34849.1"
FT                   /translation="MKYLRNVIALSLLAAAPASQAGMLAVEAGVMDWSQQAEDYFGEGK
FT                   SENSFIQMKGATGSAFGDLYAHVKLEDIEDSAAIGSEINIVGQINMGDSDFNWYGQVFN
FT                   KQKPVWSETNTTLGVSWDKQFDNGLYAQLALAGHIVTADYKHFNSDFKGGFNGGYFIYT
FT                   LMKDFDIGDQNFSFVWWQEHFFGRDDLYLKLSGDGKDFGFNGSAILRWHFHEQISAALT
FT                   YRYAENNMGKEGFHDGVFYSLQYNF"
     MKYLRNVIAL SLLAAAPASQ AGMLAVEAGV MDWSQQAEDY FGEGKSENSF IQMKGATGSA        60
     FGDLYAHVKL EDIEDSAAIG SEINIVGQIN MGDSDFNWYG QVFNKQKPVW SETNTTLGVS       120
     WDKQFDNGLY AQLALAGHIV TADYKHFNSD FKGGFNGGYF IYTLMKDFDI GDQNFSFVWW       180
     QEHFFGRDDL YLKLSGDGKD FGFNGSAILR WHFHEQISAA LTYRYAENNM GKEGFHDGVF       240
     YSLQYNF                                                                 247
//

If you have problems or comments...

PBIL Back to PBIL home page